U18 (NC_001716) Virus Tagged ORF Clone
CAT#: VC101557
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL37 [Human herpesvirus 7], codon optimized for human cell expression, YP_073758
View other clones from "Virus" (83)
Need custom modification / cloning service?
Get a free quote
CN¥ 3,800.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC101557 represents NCBI reference of YP_073758 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGTAAGGAGATGATGTTTTTTGTATTTCTTATTTGCCTTAGCCTCACACTTATGTCCAATCTGAAGT GCCATCAGAACATCATCTTCCTGGATAACAAGCTCGAGGCAGTGTGCGTCACTACATGCTATGTGAACGA GATGCTGATCGGCAACAGTAGCTGTTTGTCCGTGCGCACAGCCTTCCTGATCTCACTGTCTCTGAAAACA GAAGGGTTCCGAGAAATGAGCCTCGTCAACCTGACCACAACAAGCCATAAACTCACTTACCTTAGGGTTC TGATTAATTACTACTTCAGAGGAGTGATGCTGCGCGCCCTGATTGCAAAAAAATGGCACTTCGCTAGTCG CGCCAACTCTACCCTTGAGTGTTGGCTTGAAGGGCACAATAGCGGGGGCTCAATCACAATCATGACAGGT GGACAGAAGTTCCTCCTGCAGCTGAGATCAGGCATCGTGGCAGTCAAGTGGCGATCTGTAGGAAAAGATA AGAACAAGACCCTGGAAATTCTCAATCAGAAATTCAATTACGACTGTTATTTCGTGGCTATGATCTGCCC CCATCTGAGTGACGAAATATATCAGCGAAAGGTGTTGAACCCCAATTTTACTATAGTCCGCAACGAAACT ATTTACAAGCGCTTTCTCCGGAAGACATGGAAATCCTCTTGGCTGGATTGGTACAAGTACAAAGAGCTGG AAGACCTCTCCGCTTCATATGGCGGAAAGAATGTCATTTTCCTGAACGATTACGAGTCCTTCCTCGATCA GACTCAGGCAACTACTATCGGCGTCGTTTTCCTCGTAGGCGGAAGCGCAATGGTGTTGTTCCTGTTTTTT TGCCTCTCTATCGTGAACCGGAGGAAGGTGGACAAGAACGTTGGA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101557 representing YP_073758
Red=Cloning sites Green=Tags MGKEMMFFVFLICLSLTLMSNLKCHQNIIFLDNKLEAVCVTTCYVNEMLIGNSSCLSVRTAFLISLSLKT EGFREMSLVNLTTTSHKLTYLRVLINYYFRGVMLRALIAKKWHFASRANSTLECWLEGHNSGGSITIMTG GQKFLLQLRSGIVAVKWRSVGKDKNKTLEILNQKFNYDCYFVAMICPHLSDEIYQRKVLNPNFTIVRNET IYKRFLRKTWKSSWLDWYKYKELEDLSASYGGKNVIFLNDYESFLDQTQATTIGVVFLVGGSAMVLFLFF CLSIVNRRKVDKNVG TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001716 |
ORF Size | 885 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NC_001716.2, YP_073758 |
RefSeq ORF | 885 bp |
Locus ID | 3289476 |
MW | 34.0 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC101544 | Myc-DDK-tagged ORF clone of viral ORF for protein DR1 [Human herpesvirus 7], codon optimized for human cell expression, YP_073744 |
CN¥ 5,800.00 |
|
VC101545 | Myc-DDK-tagged ORF clone of viral ORF for protein DR6 [Human herpesvirus 7], codon optimized for human cell expression, YP_073745 |
CN¥ 4,940.00 |
|
VC101546 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL23 [Human herpesvirus 7], codon optimized for human cell expression, YP_073746 |
CN¥ 4,280.00 |
|
VC101547 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL24 [Human herpesvirus 7], codon optimized for human cell expression, YP_073747 |
CN¥ 4,560.00 |
|
VC101548 | Myc-DDK-tagged ORF clone of viral ORF for protein UL27 [Human herpesvirus 7], codon optimized for human cell expression, YP_073748 |
CN¥ 6,560.00 |
|
VC101549 | Myc-DDK-tagged ORF clone of viral ORF for protein UL28 [Human herpesvirus 7], codon optimized for human cell expression, YP_073749 |
CN¥ 18,720.00 |
|
VC101550 | Myc-DDK-tagged ORF clone of viral ORF for protein UL31 [Human herpesvirus 7], codon optimized for human cell expression, YP_073751 |
CN¥ 5,510.00 |
|
VC101551 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp150 [Human herpesvirus 7], codon optimized for human cell expression, YP_073752 |
CN¥ 11,310.00 |
|
VC101552 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL33 [Human herpesvirus 7], codon optimized for human cell expression, YP_073753 |
CN¥ 3,800.00 |
|
VC101553 | Myc-DDK-tagged ORF clone of viral ORF for protein U13 [Human herpesvirus 7], codon optimized for human cell expression, YP_073754 |
CN¥ 3,800.00 |
|
VC101554 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL35 [Human herpesvirus 7], codon optimized for human cell expression, YP_073755 |
CN¥ 7,790.00 |
|
VC101555 | Myc-DDK-tagged ORF clone of viral ORF for protein U15 [Human herpesvirus 7], codon optimized for human cell expression, YP_073756 |
CN¥ 3,800.00 |
|
VC101556 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein vICA [Human herpesvirus 7], codon optimized for human cell expression, YP_073757 |
CN¥ 3,800.00 |
|
VC101558 | Myc-DDK-tagged ORF clone of viral ORF for protein UL38 [Human herpesvirus 7], codon optimized for human cell expression, YP_073759 |
CN¥ 3,800.00 |
|
VC101559 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein U20 [Human herpesvirus 7], codon optimized for human cell expression, YP_073760 |
CN¥ 4,660.00 |
|
VC101560 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein U21 [Human herpesvirus 7], codon optimized for human cell expression, YP_073761 |
CN¥ 5,320.00 |
|
VC101561 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein U23 [Human herpesvirus 7], codon optimized for human cell expression, YP_073762 |
CN¥ 3,800.00 |
|
VC101562 | Myc-DDK-tagged ORF clone of viral ORF for protein U24 [Human herpesvirus 7], codon optimized for human cell expression, YP_073763 |
CN¥ 3,800.00 |
|
VC101563 | Myc-DDK-tagged ORF clone of viral ORF for protein U24A [Human herpesvirus 7], codon optimized for human cell expression, YP_073764 |
CN¥ 3,800.00 |
|
VC101564 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL43 [Human herpesvirus 7], codon optimized for human cell expression, YP_073765 |
CN¥ 3,800.00 |
|
VC101565 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL43 [Human herpesvirus 7], codon optimized for human cell expression, YP_073766 |
CN¥ 3,800.00 |
|
VC101566 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase processivity subunit [Human herpesvirus 7], codon optimized for human cell expression, YP_073767 |
CN¥ 4,370.00 |
|
VC101567 | Myc-DDK-tagged ORF clone of viral ORF for ribonucleotide reductase subunit 1 [Human herpesvirus 7], codon optimized for human cell expression, YP_073768 |
CN¥ 12,260.00 |
|
VC101568 | Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 1 [Human herpesvirus 7], codon optimized for human cell expression, YP_073769 |
CN¥ 3,800.00 |
|
VC101569 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL37 [Human herpesvirus 7], codon optimized for human cell expression, YP_073770 |
CN¥ 14,160.00 |
|
VC101571 | Myc-DDK-tagged ORF clone of viral ORF for small capsid protein [Human herpesvirus 7], codon optimized for human cell expression, YP_073772 |
CN¥ 3,800.00 |
|
VC101572 | Myc-DDK-tagged ORF clone of viral ORF for protein UL49 [Human herpesvirus 7], codon optimized for human cell expression, YP_073773 |
CN¥ 5,800.00 |
|
VC101573 | Myc-DDK-tagged ORF clone of viral ORF for nuclear egress membrane protein [Human herpesvirus 7], codon optimized for human cell expression, YP_073774 |
CN¥ 3,800.00 |
|
VC101574 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL33 [Human herpesvirus 7], codon optimized for human cell expression, YP_073775 |
CN¥ 3,800.00 |
|
VC101575 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL32 [Human herpesvirus 7], codon optimized for human cell expression, YP_073776 |
CN¥ 5,890.00 |
|
VC101576 | Myc-DDK-tagged ORF clone of viral ORF for nuclear egress lamina protein [Human herpesvirus 7], codon optimized for human cell expression, YP_073777 |
CN¥ 3,800.00 |
|
VC101577 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase catalytic subunit [Human herpesvirus 7], codon optimized for human cell expression, YP_073778 |
CN¥ 15,390.00 |
|
VC101578 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein B [Human herpesvirus 7], codon optimized for human cell expression, YP_073779 |
CN¥ 12,450.00 |
|
VC101579 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 2 [Human herpesvirus 7], codon optimized for human cell expression, YP_073780 |
CN¥ 10,830.00 |
|
VC101580 | Myc-DDK-tagged ORF clone of viral ORF for single-stranded DNA-binding protein [Human herpesvirus 7], codon optimized for human cell expression, YP_073781 |
CN¥ 17,100.00 |
|
VC101581 | Myc-DDK-tagged ORF clone of viral ORF for multifunctional expression regulator [Human herpesvirus 7], codon optimized for human cell expression, YP_073782 |
CN¥ 6,270.00 |
|
VC101582 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase primase subunit [Human herpesvirus 7], codon optimized for human cell expression, YP_073783 |
CN¥ 13,020.00 |
|
VC101583 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL51 [Human herpesvirus 7], codon optimized for human cell expression, YP_073784 |
CN¥ 3,800.00 |
|
VC101584 | Myc-DDK-tagged ORF clone of viral ORF for deoxyuridine triphosphatase [Human herpesvirus 7], codon optimized for human cell expression, YP_073785 |
CN¥ 4,470.00 |
|
VC101585 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein N [Human herpesvirus 7], codon optimized for human cell expression, YP_073786 |
CN¥ 3,800.00 |
|
VC101586 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein O [Human herpesvirus 7], codon optimized for human cell expression, YP_073787 |
CN¥ 3,800.00 |
|
VC101587 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein 24 [Human herpesvirus 7], codon optimized for human cell expression, YP_495283 |
CN¥ 3,800.00 |
|
VC101588 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein H [Human herpesvirus 7], codon optimized for human cell expression, YP_073788 |
CN¥ 10,450.00 |
|
VC101589 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL24 [Human herpesvirus 7], codon optimized for human cell expression, YP_073789 |
CN¥ 3,800.00 |
|
VC101590 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging tegument protein UL25 [Human herpesvirus 7], codon optimized for human cell expression, YP_073790 |
CN¥ 6,650.00 |
|
VC101591 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL78 [Human herpesvirus 7], codon optimized for human cell expression, YP_073791 |
CN¥ 3,800.00 |
|
VC101592 | Myc-DDK-tagged ORF clone of viral ORF for protein UL79 [Human herpesvirus 7], codon optimized for human cell expression, YP_073792 |
CN¥ 3,800.00 |
|
VC101593 | Myc-DDK-tagged ORF clone of viral ORF for capsid maturation protease [Human herpesvirus 7], codon optimized for human cell expression, YP_073793 |
CN¥ 6,270.00 |
|
VC101594 | Myc-DDK-tagged ORF clone of viral ORF for capsid scaffold protein [Human herpesvirus 7], codon optimized for human cell expression, YP_073794 |
CN¥ 3,800.00 |
|
VC101595 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp65 [Human herpesvirus 7], codon optimized for human cell expression, YP_073795 |
CN¥ 5,510.00 |
|
VC101596 | Myc-DDK-tagged ORF clone of viral ORF for protein UL84 [Human herpesvirus 7], codon optimized for human cell expression, YP_073796 |
CN¥ 5,230.00 |
|
VC101597 | Myc-DDK-tagged ORF clone of viral ORF for protein U55B [Human herpesvirus 7], codon optimized for human cell expression, YP_073797 |
CN¥ 5,320.00 |
|
VC101598 | Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 2 [Human herpesvirus 7], codon optimized for human cell expression, YP_073798 |
CN¥ 3,800.00 |
|
VC101599 | Myc-DDK-tagged ORF clone of viral ORF for major capsid protein [Human herpesvirus 7], codon optimized for human cell expression, YP_073799 |
CN¥ 20,330.00 |
|
VC101600 | Myc-DDK-tagged ORF clone of viral ORF for protein UL87 [Human herpesvirus 7], codon optimized for human cell expression, YP_073800 |
CN¥ 11,690.00 |
|
VC101601 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL88 [Human herpesvirus 7], codon optimized for human cell expression, YP_073801 |
CN¥ 4,180.00 |
|
VC101602 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 1 [Human herpesvirus 7], codon optimized for human cell expression, YP_073802 |
CN¥ 7,980.00 |
|
VC101603 | Myc-DDK-tagged ORF clone of viral ORF for protein UL91 [Human herpesvirus 7], codon optimized for human cell expression, YP_073803 |
CN¥ 3,800.00 |
|
VC101604 | Myc-DDK-tagged ORF clone of viral ORF for protein UL92 [Human herpesvirus 7], codon optimized for human cell expression, YP_073804 |
CN¥ 3,800.00 |
|
VC101605 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging tegument protein UL17 [Human herpesvirus 7], codon optimized for human cell expression, YP_073805 |
CN¥ 5,420.00 |
|
VC101606 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL16 [Human herpesvirus 7], codon optimized for human cell expression, YP_073806 |
CN¥ 3,800.00 |
|
VC101607 | Myc-DDK-tagged ORF clone of viral ORF for protein UL95 [Human herpesvirus 7], codon optimized for human cell expression, YP_073807 |
CN¥ 4,180.00 |
|
VC101608 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL14 [Human herpesvirus 7], codon optimized for human cell expression, YP_073808 |
CN¥ 3,800.00 |
|
VC101609 | Myc-DDK-tagged ORF clone of viral ORF for tegument serine/threonine protein kinase [Human herpesvirus 7], codon optimized for human cell expression, YP_073809 |
CN¥ 6,650.00 |
|
VC101610 | Myc-DDK-tagged ORF clone of viral ORF for deoxyribonuclease [Human herpesvirus 7], codon optimized for human cell expression, YP_073810 |
CN¥ 5,890.00 |
|
VC101611 | Myc-DDK-tagged ORF clone of viral ORF for myristylated tegument protein [Human herpesvirus 7], codon optimized for human cell expression, YP_073811 |
CN¥ 3,800.00 |
|
VC101612 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein M [Human herpesvirus 7], codon optimized for human cell expression, YP_073812 |
CN¥ 4,180.00 |
|
VC101613 | Myc-DDK-tagged ORF clone of viral ORF for DNA replication origin-binding helicase [Human herpesvirus 7], codon optimized for human cell expression, YP_073813 |
CN¥ 11,970.00 |
|
VC101614 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase subunit [Human herpesvirus 7], codon optimized for human cell expression, YP_073814 |
CN¥ 7,890.00 |
|
VC101615 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL7 [Human herpesvirus 7], codon optimized for human cell expression, YP_073815 |
CN¥ 3,800.00 |
|
VC101616 | Myc-DDK-tagged ORF clone of viral ORF for capsid portal protein [Human herpesvirus 7], codon optimized for human cell expression, YP_073816 |
CN¥ 7,700.00 |
|
VC101617 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase helicase subunit [Human herpesvirus 7], codon optimized for human cell expression, YP_073817 |
CN¥ 12,450.00 |
|
VC101619 | Myc-DDK-tagged ORF clone of viral ORF for uracil-DNA glycosylase [Human herpesvirus 7], codon optimized for human cell expression, YP_073819 |
CN¥ 3,800.00 |
|
VC101620 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein L [Human herpesvirus 7], codon optimized for human cell expression, YP_073820 |
CN¥ 3,800.00 |
|
VC101621 | Myc-DDK-tagged ORF clone of viral ORF for protein UL117 [Human herpesvirus 7], codon optimized for human cell expression, YP_073821 |
CN¥ 3,800.00 |
|
VC101622 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL119 [Human herpesvirus 7], codon optimized for human cell expression, YP_073822 |
CN¥ 3,800.00 |
|
VC101623 | Myc-DDK-tagged ORF clone of viral ORF for regulatory protein IE2 [Human herpesvirus 7], codon optimized for human cell expression, YP_073823 |
CN¥ 18,240.00 |
|
VC101624 | Myc-DDK-tagged ORF clone of viral ORF for regulatory protein IE1 [Human herpesvirus 7], codon optimized for human cell expression, YP_073824 |
CN¥ 18,150.00 |
|
VC101625 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL124 [Human herpesvirus 7], codon optimized for human cell expression, YP_073825 |
CN¥ 3,800.00 |
|
VC101626 | Myc-DDK-tagged ORF clone of viral ORF for protein U95 [Human herpesvirus 7], codon optimized for human cell expression, YP_073826 |
CN¥ 14,160.00 |
|
VC101627 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein Q [Human herpesvirus 7], codon optimized for human cell expression, YP_073827 |
CN¥ 7,220.00 |
|
VC101628 | Myc-DDK-tagged ORF clone of viral ORF for protein DR1 [Human herpesvirus 7], codon optimized for human cell expression, YP_073828 |
CN¥ 5,800.00 |
|
VC101629 | Myc-DDK-tagged ORF clone of viral ORF for protein DR6 [Human herpesvirus 7], codon optimized for human cell expression, YP_073829 |
CN¥ 5,488.00 |