U6 (NC_000898) Virus Tagged ORF Clone
CAT#: VC101450
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp014 [Human herpesvirus 6], codon optimized for human cell expression, NP_050188
View other clones from "Virus" (98)
Need custom modification / cloning service?
Get a free quote
CNY 3,800.00
Cited in 13 publications. |
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC101450 represents NCBI reference of NP_050188 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCAAACTTGGCTGCAGCTGTGCCGTGCAGACCCTTTGTGAACCTCGCACAGGAGACCGGGACAACTA ACCTGCTGGTAGCTGGAAGCCGGCCGACCAATACTGGGGTGCGGAATTTCGTCATTAATCTTACAGTGTC CGAGTCAAGCAGTTCCCGACGGACTGCAAACAGAATTCTGCTCAGATCCTTTACCTCCCTTCTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101450 representing NP_050188
Red=Cloning sites Green=Tags MPNLAAAVPCRPFVNLAQETGTTNLLVAGSRPTNTGVRNFVINLTVSESSSSRRTANRILLRSFTSLL TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_000898 |
ORF Size | 204 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NC_000898.1, NP_050188 |
RefSeq ORF | 204 bp |
Locus ID | 1497008 |
MW | 7.3 kDa |
Citations (13)
The use of this cDNA Clones has been cited in the following citations: |
---|
FOXO3-dependent suppression of PD-L1 promotes anticancer immune responses via activation of natural killer cells
,null,
American Journal of Cancer Research
,PubMed ID 35411241
[U6]
|
Sensitizing tumors to anti-PD-1 therapy by promoting NK and CD8+ T cells via pharmacological activation of FOXO3
,null,
Journal for Immunotherapy of Cancer
,PubMed ID 34887262
[U6]
|
Modulation of CXC-motif chemokine receptor 7, but not 4, expression is related to migration of the human prostate cancer cell LNCaP: regulation by androgen and inflammatory stimuli.
,null,
Inflammation research : official journal of the European Histamine Research Society ... [et al.]
,PubMed ID 31865399
[U6]
|
Activation of airway epithelial bitter taste receptors by Pseudomonas aeruginosa quinolones modulates calcium, cyclic-AMP, and nitric oxide signaling
,null,
The Journal of Biological Chemistry
,PubMed ID 29748385
[U6]
|
Meox1 accelerates myocardial hypertrophic decompensation through Gata4.
,null,
Cardiovascular research
,PubMed ID 29155983
[U6]
|
CXCR7 maintains osteosarcoma invasion after CXCR4 suppression in bone marrow microenvironment.
,null,
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine
,PubMed ID 28468584
[U6]
|
Mechanical confinement triggers glioma linear migration dependent on formin FHOD3
,null,
Molecular Biology of the Cell
,PubMed ID 26912794
[U6]
|
Characterisation of Mesothelioma-Initiating Cells and Their Susceptibility to Anti-Cancer Agents
,null,
PLoS ONE
,PubMed ID 25932953
[U6]
|
The chemokine receptor CXCR7 interacts with EGFR to promote breast cancer cell proliferation
,null,
Molecular Cancer
,PubMed ID 25168820
[U6]
|
Reprogramming ovarian and breast cancer cells into non-cancerous cells by low-dose metformin or SN-38 through FOXO3 activation
,null,
Scientific Reports
,PubMed ID 25056111
[U6]
|
CD109 Plays a Role in Osteoclastogenesis
,null,
PLoS ONE
,PubMed ID 23593435
[U6]
|
FOXO3 signalling links ATM to the p53 apoptotic pathway following DNA damage
,null,
Nature communications
,PubMed ID 22893124
[U6]
|
Ketohexokinase-Dependent Metabolism of Fructose Induces Proinflammatory Mediators in Proximal Tubular Cells
,null,
Journal of the American Society of Nephrology : JASN
,PubMed ID 19158351
[U6]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC101440 | Myc-DDK-tagged ORF clone of viral ORF for putative DNA-directed RNA polymerase II [Human herpesvirus 6], codon optimized for human cell expression, NP_050176 |
CNY 11,500.00 |
|
VC101441 | Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050180 |
CNY 4,660.00 |
|
VC101442 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp004 [Human herpesvirus 6], codon optimized for human cell expression, NP_050179 |
CNY 3,800.00 |
|
VC101443 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp003 [Human herpesvirus 6], codon optimized for human cell expression, NP_050178 |
CNY 3,800.00 |
|
VC101444 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp002 [Human herpesvirus 6], codon optimized for human cell expression, NP_050177 |
CNY 3,800.00 |
|
VC101445 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp006 [Human herpesvirus 6], codon optimized for human cell expression, NP_050181 |
CNY 3,800.00 |
|
VC101447 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050183 |
CNY 3,800.00 |
|
VC101448 | Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050185 |
CNY 4,560.00 |
|
VC101449 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp009 [Human herpesvirus 6], codon optimized for human cell expression, NP_050186 |
CNY 6,460.00 |
|
VC101451 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp012 [Human herpesvirus 6], codon optimized for human cell expression, NP_050189 |
CNY 4,940.00 |
|
VC101452 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp015 [Human herpesvirus 6], codon optimized for human cell expression, NP_050190 |
CNY 3,800.00 |
|
VC101453 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp016 [Human herpesvirus 6], codon optimized for human cell expression, NP_050191 |
CNY 6,080.00 |
|
VC101454 | Myc-DDK-tagged ORF clone of viral ORF for antigenic virion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050192 |
CNY 9,424.00 |
|
VC101455 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp019 [Human herpesvirus 6], codon optimized for human cell expression, NP_050194 |
CNY 3,800.00 |
|
VC101456 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp020 [Human herpesvirus 6], codon optimized for human cell expression, NP_050195 |
CNY 7,320.00 |
|
VC101457 | Myc-DDK-tagged ORF clone of viral ORF for immediate-early protein 6 [Human herpesvirus 6], codon optimized for human cell expression, NP_050198 |
CNY 3,800.00 |
|
VC101458 | Myc-DDK-tagged ORF clone of viral ORF for immediate-early protein 4 [Human herpesvirus 6], codon optimized for human cell expression, NP_050199 |
CNY 4,660.00 |
|
VC101459 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050200 |
CNY 5,320.00 |
|
VC101460 | Myc-DDK-tagged ORF clone of viral ORF for putative membrane glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050201 |
CNY 6,080.00 |
|
VC101461 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp013 [Human herpesvirus 6], codon optimized for human cell expression, NP_050187 |
CNY 13,590.00 |
|
VC101462 | Myc-DDK-tagged ORF clone of viral ORF for transcription regulator [Human herpesvirus 6], codon optimized for human cell expression, NP_050197 |
CNY 3,990.00 |
|
VC101463 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050202 |
CNY 3,800.00 |
|
VC101464 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp027 [Human herpesvirus 6], codon optimized for human cell expression, NP_050204 |
CNY 1,200.00 |
|
VC101465 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp026 [Human herpesvirus 6], codon optimized for human cell expression, NP_050205 |
CNY 3,800.00 |
|
VC101466 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp025 [Human herpesvirus 6], codon optimized for human cell expression, NP_050206 |
CNY 3,800.00 |
|
VC101467 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp033 [Human herpesvirus 6], codon optimized for human cell expression, NP_050207 |
CNY 3,800.00 |
|
VC101468 | Myc-DDK-tagged ORF clone of viral ORF for Polymerase processivity factor [Human herpesvirus 6], codon optimized for human cell expression, NP_050208 |
CNY 4,370.00 |
|
VC101469 | Myc-DDK-tagged ORF clone of viral ORF for large ribonuclease reductase [Human herpesvirus 6], codon optimized for human cell expression, NP_050209 |
CNY 12,260.00 |
|
VC101470 | Myc-DDK-tagged ORF clone of viral ORF for capsid assembly and DNA maturation [Human herpesvirus 6], codon optimized for human cell expression, NP_050210 |
CNY 3,800.00 |
|
VC101471 | Myc-DDK-tagged ORF clone of viral ORF for capsid assembly protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050211 |
CNY 16,340.00 |
|
VC101473 | Myc-DDK-tagged ORF clone of viral ORF for putative capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050213 |
CNY 3,800.00 |
|
VC101474 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050214 |
CNY 5,700.00 |
|
VC101475 | Myc-DDK-tagged ORF clone of viral ORF for putative virion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050215 |
CNY 3,800.00 |
|
VC101476 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp038 [Human herpesvirus 6], codon optimized for human cell expression, NP_050216 |
CNY 3,800.00 |
|
VC101477 | Myc-DDK-tagged ORF clone of viral ORF for virion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050217 |
CNY 5,890.00 |
|
VC101478 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp043 [Human herpesvirus 6], codon optimized for human cell expression, NP_050218 |
CNY 3,800.00 |
|
VC101479 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase [Human herpesvirus 6], codon optimized for human cell expression, NP_050219 |
CNY 15,390.00 |
|
VC101480 | Myc-DDK-tagged ORF clone of viral ORF for Glycoprotein B [Human herpesvirus 6], codon optimized for human cell expression, NP_050220 |
CNY 12,640.00 |
|
VC101481 | Myc-DDK-tagged ORF clone of viral ORF for transport/capsid assembly [Human herpesvirus 6], codon optimized for human cell expression, NP_050221 |
CNY 10,930.00 |
|
VC101482 | Myc-DDK-tagged ORF clone of viral ORF for major DNA binding protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050222 |
CNY 17,100.00 |
|
VC101483 | Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050223 |
CNY 6,270.00 |
|
VC101484 | Myc-DDK-tagged ORF clone of viral ORF for helicase/primase complex [Human herpesvirus 6], codon optimized for human cell expression, NP_050224 |
CNY 13,020.00 |
|
VC101485 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp050 [Human herpesvirus 6], codon optimized for human cell expression, NP_050225 |
CNY 3,800.00 |
|
VC101486 | Myc-DDK-tagged ORF clone of viral ORF for putative dUTPase [Human herpesvirus 6], codon optimized for human cell expression, NP_050226 |
CNY 4,470.00 |
|
VC101487 | Myc-DDK-tagged ORF clone of viral ORF for putative membrane /secreted protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050227 |
CNY 3,800.00 |
|
VC101488 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein O [Human herpesvirus 6], codon optimized for human cell expression, NP_050228 |
CNY 11,120.00 |
|
VC101489 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein H [Human herpesvirus 6], codon optimized for human cell expression, NP_050229 |
CNY 10,450.00 |
|
VC101490 | Myc-DDK-tagged ORF clone of viral ORF for putative fusion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050230 |
CNY 3,800.00 |
|
VC101491 | Myc-DDK-tagged ORF clone of viral ORF for viron protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050231 |
CNY 6,750.00 |
|
VC101492 | Myc-DDK-tagged ORF clone of viral ORF for G-protein coupled receptor [Human herpesvirus 6], codon optimized for human cell expression, NP_050232 |
CNY 3,800.00 |
|
VC101493 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp058 [Human herpesvirus 6], codon optimized for human cell expression, NP_050233 |
CNY 3,800.00 |
|
VC101494 | Myc-DDK-tagged ORF clone of viral ORF for proteinase [Human herpesvirus 6], codon optimized for human cell expression, NP_050234 |
CNY 6,370.00 |
|
VC101495 | Myc-DDK-tagged ORF clone of viral ORF for virion transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050235 |
CNY 5,610.00 |
|
VC101496 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp062 [Human herpesvirus 6], codon optimized for human cell expression, NP_050236 |
CNY 5,990.00 |
|
VC101497 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050237 |
CNY 3,800.00 |
|
VC101498 | Myc-DDK-tagged ORF clone of viral ORF for major capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050238 |
CNY 20,330.00 |
|
VC101499 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp064 [Human herpesvirus 6], codon optimized for human cell expression, NP_050239 |
CNY 11,690.00 |
|
VC101500 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp065 [Human herpesvirus 6], codon optimized for human cell expression, NP_050240 |
CNY 4,180.00 |
|
VC101501 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp067 [Human herpesvirus 6], codon optimized for human cell expression, NP_050242 |
CNY 3,800.00 |
|
VC101502 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp068 [Human herpesvirus 6], codon optimized for human cell expression, NP_050243 |
CNY 3,800.00 |
|
VC101503 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050244 |
CNY 5,420.00 |
|
VC101504 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050245 |
CNY 3,990.00 |
|
VC101505 | Myc-DDK-tagged ORF clone of viral ORF for Putative terminase [Human herpesvirus 6], codon optimized for human cell expression, NP_050241 |
CNY 7,980.00 |
|
VC101506 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp071 [Human herpesvirus 6], codon optimized for human cell expression, NP_050246 |
CNY 4,180.00 |
|
VC101507 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp072 [Human herpesvirus 6], codon optimized for human cell expression, NP_050247 |
CNY 3,800.00 |
|
VC101508 | Myc-DDK-tagged ORF clone of viral ORF for Phosphotransferase [Human herpesvirus 6], codon optimized for human cell expression, NP_050248 |
CNY 6,840.00 |
|
VC101509 | Myc-DDK-tagged ORF clone of viral ORF for Alkaline exonuclease [Human herpesvirus 6], codon optimized for human cell expression, NP_050249 |
CNY 5,990.00 |
|
VC101510 | Myc-DDK-tagged ORF clone of viral ORF for Myristylated virion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050250 |
CNY 3,800.00 |
|
VC101511 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein M [Human herpesvirus 6], codon optimized for human cell expression, NP_050251 |
CNY 4,090.00 |
|
VC101512 | Myc-DDK-tagged ORF clone of viral ORF for origin binding protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050252 |
CNY 11,880.00 |
|
VC101513 | Myc-DDK-tagged ORF clone of viral ORF for helicase/primase complex [Human herpesvirus 6], codon optimized for human cell expression, NP_050253 |
CNY 7,890.00 |
|
VC101514 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp080 [Human herpesvirus 6], codon optimized for human cell expression, NP_050254 |
CNY 3,800.00 |
|
VC101515 | Myc-DDK-tagged ORF clone of viral ORF for putative viron protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050255 |
CNY 7,890.00 |
|
VC101516 | Myc-DDK-tagged ORF clone of viral ORF for Helicase/primase complex [Human herpesvirus 6], codon optimized for human cell expression, NP_050256 |
CNY 12,540.00 |
|
VC101517 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp082 [Human herpesvirus 6], codon optimized for human cell expression, NP_050257 |
CNY 3,800.00 |
|
VC101518 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp083 [Human herpesvirus 6], codon optimized for human cell expression, NP_050258 |
CNY 3,800.00 |
|
VC101519 | Myc-DDK-tagged ORF clone of viral ORF for DNA replication [Human herpesvirus 6], codon optimized for human cell expression, NP_050259 |
CNY 5,890.00 |
|
VC101520 | Myc-DDK-tagged ORF clone of viral ORF for Uracyl-DNA glycosylase [Human herpesvirus 6], codon optimized for human cell expression, NP_050260 |
CNY 3,800.00 |
|
VC101521 | Myc-DDK-tagged ORF clone of viral ORF for Glycoprotein L [Human herpesvirus 6], codon optimized for human cell expression, NP_050261 |
CNY 3,800.00 |
|
VC101522 | Myc-DDK-tagged ORF clone of viral ORF for Intercrine cytokine [Human herpesvirus 6], codon optimized for human cell expression, NP_050262 |
CNY 3,800.00 |
|
VC101523 | Myc-DDK-tagged ORF clone of viral ORF for putative glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050263 |
CNY 4,090.00 |
|
VC101524 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050264 |
CNY 3,800.00 |
|
VC101526 | Myc-DDK-tagged ORF clone of viral ORF for IE-A transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050266 |
CNY 16,340.00 |
|
VC101527 | Myc-DDK-tagged ORF clone of viral ORF for probable membrane glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050267 |
CNY 3,800.00 |
|
VC101529 | Myc-DDK-tagged ORF clone of viral ORF for Parvovirus rep homolog [Human herpesvirus 6], codon optimized for human cell expression, NP_050269 |
CNY 4,024.00 |
|
VC101530 | Myc-DDK-tagged ORF clone of viral ORF for immediate-early protein IE2 [Human herpesvirus 6], codon optimized for human cell expression, NP_050270 |
CNY 18,340.00 |
|
VC101531 | Myc-DDK-tagged ORF clone of viral ORF for spliced envelope glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050271 |
CNY 7,410.00 |
|
VC101533 | Myc-DDK-tagged ORF clone of viral ORF for putative DNA-directed RNA polymerase [Human herpesvirus 6], codon optimized for human cell expression, NP_050273 |
CNY 11,500.00 |
|
VC101534 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp099 [Human herpesvirus 6], codon optimized for human cell expression, NP_050274 |
CNY 3,800.00 |
|
VC101535 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp100 [Human herpesvirus 6], codon optimized for human cell expression, NP_050275 |
CNY 3,800.00 |
|
VC101536 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp101 [Human herpesvirus 6], codon optimized for human cell expression, NP_050276 |
CNY 3,800.00 |
|
VC101537 | Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050277 |
CNY 4,660.00 |
|
VC101538 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp103 [Human herpesvirus 6], codon optimized for human cell expression, NP_050278 |
CNY 3,800.00 |
|
VC101539 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050203 |
CNY 3,800.00 |
|
VC101540 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp021 [Human herpesvirus 6], codon optimized for human cell expression, NP_050196 |
CNY 3,800.00 |
|
VC101541 | Myc-DDK-tagged ORF clone of viral ORF for G-protein coupled receptor [Human herpesvirus 6], codon optimized for human cell expression, NP_050193 |
CNY 3,800.00 |
|
VC101542 | Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050184 |
CNY 4,370.00 |
|
VC101543 | Myc-DDK-tagged ORF clone of viral ORF for G-protein coupled receptor fragment [Human herpesvirus 6], codon optimized for human cell expression, NP_597817 |
CNY 3,800.00 |