U38 (NC_001664) Virus Tagged ORF Clone

CAT＃: VC101386

  • TrueORF®

Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase catalytic subunit [Human herpesvirus 6], codon optimized for human cell expression, NP_042931

Datasheet
SDS

  View other clones from "Virus" (85)

Need custom modification / cloning service?
Get a free quote

CNY 15,390.00

货期*
7周
规格
    • 10 ug

Product images

经常一起买 (4)
PS100001
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00

添加到购物车
CC100003
DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00

暂停销售
TA592569
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

添加到购物车

【特别福利】购一抗正装产品（≥50ul或≥50ug），免费领10ul抗体试用装

TA50011-100
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

添加到购物车

【特别福利】购一抗正装产品（≥50ul或≥50ug），免费领10ul抗体试用装

Specifications

Product Data
Type Virus Tagged ORF Clone
Tag Myc-DDK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>The Viral ORF clone VC101386 represents NCBI reference of NP_042931 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATTCCGTAAGCTTCTTTAACCCATACCTGGAGGCAAACCGCTTGAAGAAGAAAAGCCGGTCCAGTT
ACATCAGGATACTCCCAAGGGGCATCATGCACGATGGCGCCGCCGGACTTATCAAAGACGTGTGCGACTC
AGAGCCTCGGATGTTCTACCGGGATAGACAGTATCTGCTGAGCAAGGAAATGACTTGGCCCAGCCTCGAT
ATAGCTAGAAGTAAGGACTACGATCATATGAGGATGAAGTTTCATATTTATGACGCGGTGGAGACTCTCA
TGTTTACAGACTCTATAGAGAATCTTCCTTTCCAGTACAGACATTTCGTTATCCCAAGCGGCACTGTGAT
ACGAATGTTCGGCCGCACAGAGGACGGGGAGAAAATTTGCGTGAATGTGTTTGGGCAGGAGCAGTACTTT
TACTGCGAATGCGTGGACGGGCGGTCTCTGAAAGCAACTATCAACAATTTGATGCTTACCGGAGAAGTTA
AAATGTCTTGTTCCTTCGTTATTGAGCCCGCTGATAAACTGTCTCTCTACGGGTACAATGCCAATACCGT
CGTGAATCTCTTCAAGGTTAGCTTCGGAAATTTCTATGTGTCTCAGAGGATTGGTAAGATCCTGCAAAAT
GAGGGCTTCGTGGTATACGAGATCGACGTCGACGTGCTGACACGCTTCTTCGTCGATAACGGCTTTCTGA
GCTTTGGCTGGTACAATGTCAAGAAGTATATCCCTCAGGACATGGGCAAGGGGTCTAATCTCGAGGTCGA
GATCAATTGCCACGTGAGCGATCTGGTGAGCCTCGAAGACGTCAATTGGCCACTGTATGGTTGTTGGTCT
TTCGATATCGAATGCCTGGGCCAGAATGGCAATTTCCCAGATGCAGAGAATCTGGGCGACATTGTTATCC
AGATCTCCGTGATCTCTTTCGACACCGAGGGGGATCGCGACGAGAGACACCTCTTCACTCTTGGAACCTG
TGAGAAGATAGACGGCGTGCACATCTACGAGTTTGCCTCCGAGTTCGAACTGCTCCTGGGTTTTTTTATT
TTTCTCCGAATCGAATCTCCTGAGTTCATTACCGGATACAACATTAACAATTTTGATCTGAAGTACCTTT
GTATCCGCATGGATAAAATTTATCACTATGACATTGGATGCTTCTCTAAGCTCAAGAATGGCAAGATCGG
GATCTCCGTACCTCATGAACAGTACCGAAAAGGGTTCCTTCAAGCGCAAACCAAGGTGTTTACTTCCGGT
GTGCTTTATCTGGATATGTACCCAGTCTATAGCTCAAAAATCACCGCCCAAAACTATAAGCTGGACACCA
TCGCCAAGATTTGTCTCCAGCAGGAAAAAGAGCAACTCAGTTACAAAGAGATTCCTAAGAAATTTATAAG
CGGTCCCAGCGGGCGCGCGGTGGTTGGCAAATACTGTCTGCAAGATAGCGTACTCGTGGTCCGACTGTTC
AAGCAGATTAACTATCATTTTGAAGTGGCAGAGGTCGCTAGACTGGCCCATGTGACAGCCAGATGCGTGG
TGTTCGAGGGGCAGCAAAAAAAAATTTTCCCGTGTATCCTGACCGAAGCCAAGCGCAGGAATATGATACT
GCCGTCCATGGTTAGCAGCCACAATAGACAGGGAATAGGGTACAAGGGTGCCACTGTGCTGGAGCCCAAG
ACAGGTTACTACGCAGTGCCCACGGTAGTGTTCGACTTCCAGTCCCTGTACCCCAGCATAATGATGGCCC
ACAATCTTTGTTATTCCACCCTGGTCCTCGACGAGCGCCAGATCGCCGGACTGAGCGAAAGCGATATCCT
GACCGTCAAGCTGGGCGATGAGACCCACCGGTTTGTCAAACCCTGTATTCGCGAAAGTGTGTTGGGATCC
CTGCTCAAGGATTGGCTGGCCAAGCGCAGAGAGGTCAAGGCGGAGATGCAGAACTGTTCCGACCCCATGA
TGAAACTCTTGCTGGATAAAAAACAACTGGCCCTGAAGACAACTTGTAACTCCGTGTACGGAGTCACCGG
AGCAGCTCACGGATTGCTCCCATGCGTGGCAATCGCAGCGTCCGTCACCTGCCTGGGGAGGGAAATGCTG
TGCTCTACTGTGGACTATGTAAATTCCAAAATGCAGAGCGAGCAGTTCTTCTGCGAGGAATTCGGCTTGA
CCAGTTCAGACTTTACCGGGGATCTGGAAGTTGAGGTAATTTATGGAGATACCGACTCAATATTTATGTC
CGTGAGGAATATGGTGAACCAGTCTCTCCGACGAATCGCCCCAATGATTGCAAAACACATCACCGATCGC
CTTTTCAAGAGTCCGATCAAACTGGAATTCGAAAAAATTCTGTGTCCTCTGATTCTGATCTGCAAAAAGC
GGTACATCGGAAGACAGGATGACTCTCTGCTCATCTTCAAGGGCGTGGACCTGGTCAGGAAAACCAGTTG
TGACTTCGTGAAAGGAGTGGTAAAGGATATAGTCGACCTCCTGTTTTTTGATGAGGAGGTCCAAACAGCT
GCTGTTGAGTTCAGCCATATGACACAGACCCAGCTCAGAGAGCAGGGGGTGCCGGTGGGAATCCATAAAA
TCTTGCGCAGGCTCTGTGAAGCCAGGGAGGAGCTGTTTCAAAATAGGGCTGACGTCCGACACCTGATGCT
CAGCTCTGTGTTGTCAAAAGAAATGGCCGCATACAAGCAGCCAAACTTGGCTCATCTTTCAGTGATCCGG
CGCTTGGCGCAGCGAAAAGAAGAGATCCCAAACGTGGGCGATCGGATCATGTACGTACTTATTGCGCCAA
GCATCGGCAATAAACAGACTCATAACTACGAACTGGCAGAAGATCCCAACTACGTGATAGAGCACAAGAT
CCCAATCCACGCCGAGAAATACTTCGATCAGATAATCAAAGCTGTGACTAACGCCATTAGCCCGATCTTC
CCGAAGACGGACATTAAAAAAGAAAAGCTCCTCCTGTACCTCTTGCCAATGAAAGTATACCTGGACGAGA
CCTTCTCCGCTATTGCGGAAGTGATG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
>VC101386 representing NP_042931
Red=Cloning sites Green=Tags

MDSVSFFNPYLEANRLKKKSRSSYIRILPRGIMHDGAAGLIKDVCDSEPRMFYRDRQYLLSKEMTWPSLD
IARSKDYDHMRMKFHIYDAVETLMFTDSIENLPFQYRHFVIPSGTVIRMFGRTEDGEKICVNVFGQEQYF
YCECVDGRSLKATINNLMLTGEVKMSCSFVIEPADKLSLYGYNANTVVNLFKVSFGNFYVSQRIGKILQN
EGFVVYEIDVDVLTRFFVDNGFLSFGWYNVKKYIPQDMGKGSNLEVEINCHVSDLVSLEDVNWPLYGCWS
FDIECLGQNGNFPDAENLGDIVIQISVISFDTEGDRDERHLFTLGTCEKIDGVHIYEFASEFELLLGFFI
FLRIESPEFITGYNINNFDLKYLCIRMDKIYHYDIGCFSKLKNGKIGISVPHEQYRKGFLQAQTKVFTSG
VLYLDMYPVYSSKITAQNYKLDTIAKICLQQEKEQLSYKEIPKKFISGPSGRAVVGKYCLQDSVLVVRLF
KQINYHFEVAEVARLAHVTARCVVFEGQQKKIFPCILTEAKRRNMILPSMVSSHNRQGIGYKGATVLEPK
TGYYAVPTVVFDFQSLYPSIMMAHNLCYSTLVLDERQIAGLSESDILTVKLGDETHRFVKPCIRESVLGS
LLKDWLAKRREVKAEMQNCSDPMMKLLLDKKQLALKTTCNSVYGVTGAAHGLLPCVAIAASVTCLGREML
CSTVDYVNSKMQSEQFFCEEFGLTSSDFTGDLEVEVIYGDTDSIFMSVRNMVNQSLRRIAPMIAKHITDR
LFKSPIKLEFEKILCPLILICKKRYIGRQDDSLLIFKGVDLVRKTSCDFVKGVVKDIVDLLFFDEEVQTA
AVEFSHMTQTQLREQGVPVGIHKILRRLCEAREELFQNRADVRHLMLSSVLSKEMAAYKQPNLAHLSVIR
RLAQRKEEIPNVGDRIMYVLIAPSIGNKQTHNYELAEDPNYVIEHKIPIHAEKYFDQIIKAVTNAISPIF
PKTDIKKEKLLLYLLPMKVYLDETFSAIAEVM

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
ACCN NC_001664
ORF Size 3036 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NC_001664.2, NP_042931
RefSeq ORF 3036 bp
Locus ID 1487916
MW 115.8 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

SKU Description Size Price
VC101352 Myc-DDK-tagged ORF clone of viral ORF for protein DR1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042883
    • 10 ug

CNY 10,360.00

VC101353 Myc-DDK-tagged ORF clone of viral ORF for protein DR6 [Human herpesvirus 6], codon optimized for human cell expression, NP_042888
    • 10 ug

CNY 4,660.00

VC101354 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL23 [Human herpesvirus 6], codon optimized for human cell expression, NP_042893
    • 10 ug

CNY 4,370.00

VC101355 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL24 [Human herpesvirus 6], codon optimized for human cell expression, NP_042894
    • 10 ug

CNY 4,470.00

VC101356 Myc-DDK-tagged ORF clone of viral ORF for protein UL27 [Human herpesvirus 6], codon optimized for human cell expression, NP_042895
    • 10 ug

CNY 6,460.00

VC101357 Myc-DDK-tagged ORF clone of viral ORF for protein UL28 [Human herpesvirus 6], codon optimized for human cell expression, NP_042898
    • 10 ug

CNY 18,620.00

VC101358 Myc-DDK-tagged ORF clone of viral ORF for protein UL31 [Human herpesvirus 6], codon optimized for human cell expression, NP_042901
    • 10 ug

CNY 5,320.00

VC101359 Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp150 [Human herpesvirus 6], codon optimized for human cell expression, NP_042902
    • 10 ug

CNY 13,210.00

VC101360 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL33 [Human herpesvirus 6], codon optimized for human cell expression, NP_042903
    • 10 ug

CNY 4,180.00

VC101361 Myc-DDK-tagged ORF clone of viral ORF for protein U13 [Human herpesvirus 6], codon optimized for human cell expression, NP_042905
    • 10 ug

CNY 3,800.00

VC101362 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL35 [Human herpesvirus 6], codon optimized for human cell expression, NP_042906
    • 10 ug

CNY 7,320.00

VC101363 Myc-DDK-tagged ORF clone of viral ORF for protein U15 [Human herpesvirus 6], codon optimized for human cell expression, NP_042907
    • 10 ug

CNY 3,800.00

VC101364 Myc-DDK-tagged ORF clone of viral ORF for tegument protein vICA [Human herpesvirus 6], codon optimized for human cell expression, NP_042910
    • 10 ug

CNY 3,990.00

VC101365 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL37 [Human herpesvirus 6], codon optimized for human cell expression, NP_042911
    • 10 ug

CNY 3,800.00

VC101366 Myc-DDK-tagged ORF clone of viral ORF for protein UL38 [Human herpesvirus 6], codon optimized for human cell expression, NP_042912
    • 10 ug

CNY 4,660.00

VC101367 Myc-DDK-tagged ORF clone of viral ORF for membrane protein U20 [Human herpesvirus 6], codon optimized for human cell expression, NP_042913
    • 10 ug

CNY 5,230.00

VC101368 Myc-DDK-tagged ORF clone of viral ORF for membrane protein U21 [Human herpesvirus 6], codon optimized for human cell expression, NP_042914
    • 10 ug

CNY 5,320.00

VC101369 Myc-DDK-tagged ORF clone of viral ORF for membrane protein U22 [Human herpesvirus 6], codon optimized for human cell expression, NP_042915
    • 10 ug

CNY 3,800.00

VC101370 Myc-DDK-tagged ORF clone of viral ORF for membrane protein U23 [Human herpesvirus 6], codon optimized for human cell expression, NP_042916
    • 10 ug

CNY 3,800.00

VC101371 Myc-DDK-tagged ORF clone of viral ORF for protein U24 [Human herpesvirus 6], codon optimized for human cell expression, NP_042917
    • 10 ug

CNY 3,800.00

VC101372 Myc-DDK-tagged ORF clone of viral ORF for protein U24A [Human herpesvirus 6], codon optimized for human cell expression, YP_002608174
    • 10 ug

CNY 3,800.00

VC101373 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL43 [Human herpesvirus 6], codon optimized for human cell expression, NP_042918
    • 10 ug

CNY 3,800.00

VC101374 Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL43 [Human herpesvirus 6], codon optimized for human cell expression, NP_042919
    • 10 ug

CNY 3,800.00

VC101375 Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase processivity subunit [Human herpesvirus 6], codon optimized for human cell expression, NP_042920
    • 10 ug

CNY 4,370.00

VC101376 Myc-DDK-tagged ORF clone of viral ORF for ribonucleotide reductase subunit 1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042921
    • 10 ug

CNY 12,260.00

VC101377 Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042922
    • 10 ug

CNY 3,800.00

VC101378 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL37 [Human herpesvirus 6], codon optimized for human cell expression, NP_042923
    • 10 ug

CNY 14,060.00

VC101380 Myc-DDK-tagged ORF clone of viral ORF for small capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042925
    • 10 ug

CNY 3,800.00

VC101381 Myc-DDK-tagged ORF clone of viral ORF for protein UL49 [Human herpesvirus 6], codon optimized for human cell expression, NP_042926
    • 10 ug

CNY 5,700.00

VC101382 Myc-DDK-tagged ORF clone of viral ORF for nuclear egress membrane protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042927
    • 10 ug

CNY 3,800.00

VC101383 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL33 [Human herpesvirus 6], codon optimized for human cell expression, NP_042928
    • 10 ug

CNY 3,800.00

VC101384 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL32 [Human herpesvirus 6], codon optimized for human cell expression, NP_042929
    • 10 ug

CNY 5,890.00

VC101385 Myc-DDK-tagged ORF clone of viral ORF for nuclear egress lamina protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042930
    • 10 ug

CNY 3,800.00

VC101387 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein B [Human herpesvirus 6], codon optimized for human cell expression, NP_042932
    • 10 ug

CNY 12,640.00

VC101388 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 2 [Human herpesvirus 6], codon optimized for human cell expression, NP_042933
    • 10 ug

CNY 10,930.00

VC101389 Myc-DDK-tagged ORF clone of viral ORF for single-stranded DNA-binding protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042934
    • 10 ug

CNY 17,100.00

VC101390 Myc-DDK-tagged ORF clone of viral ORF for multifunctional expression regulator [Human herpesvirus 6], codon optimized for human cell expression, NP_042935
    • 10 ug

CNY 6,270.00

VC101391 Myc-DDK-tagged ORF clone of viral ORF for helicase-primase primase subunit [Human herpesvirus 6], codon optimized for human cell expression, NP_042936
    • 10 ug

CNY 13,020.00

VC101392 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL51 [Human herpesvirus 6], codon optimized for human cell expression, NP_042937
    • 10 ug

CNY 3,800.00

VC101393 Myc-DDK-tagged ORF clone of viral ORF for deoxyuridine triphosphatase [Human herpesvirus 6], codon optimized for human cell expression, NP_042938
    • 10 ug

CNY 4,470.00

VC101394 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein N [Human herpesvirus 6], codon optimized for human cell expression, NP_042939
    • 10 ug

CNY 3,800.00

VC101395 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein O [Human herpesvirus 6], codon optimized for human cell expression, NP_042940
    • 10 ug

CNY 7,410.00

VC101396 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein 24 [Human herpesvirus 6], codon optimized for human cell expression, YP_002608175
    • 10 ug

CNY 3,800.00

VC101397 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein H [Human herpesvirus 6], codon optimized for human cell expression, NP_042941
    • 10 ug

CNY 10,450.00

VC101398 Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL24 [Human herpesvirus 6], codon optimized for human cell expression, NP_042942
    • 10 ug

CNY 3,800.00

VC101399 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging tegument protein UL25 [Human herpesvirus 6], codon optimized for human cell expression, NP_042943
    • 10 ug

CNY 6,750.00

VC101400 Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL78 [Human herpesvirus 6], codon optimized for human cell expression, NP_042944
    • 10 ug

CNY 3,800.00

VC101401 Myc-DDK-tagged ORF clone of viral ORF for protein UL79 [Human herpesvirus 6], codon optimized for human cell expression, NP_042945
    • 10 ug

CNY 3,800.00

VC101402 Myc-DDK-tagged ORF clone of viral ORF for capsid maturation protease [Human herpesvirus 6], codon optimized for human cell expression, NP_042946
    • 10 ug

CNY 6,370.00

VC101403 Myc-DDK-tagged ORF clone of viral ORF for capsid scaffold protein [Human herpesvirus 6], codon optimized for human cell expression, YP_002608176
    • 10 ug

CNY 3,800.00

VC101404 Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp65 [Human herpesvirus 6], codon optimized for human cell expression, NP_042947
    • 10 ug

CNY 4,024.00

VC101405 Myc-DDK-tagged ORF clone of viral ORF for protein UL84 [Human herpesvirus 6], codon optimized for human cell expression, NP_042948
    • 10 ug

CNY 5,320.00

VC101406 Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 2 [Human herpesvirus 6], codon optimized for human cell expression, NP_042949
    • 10 ug

CNY 3,800.00

VC101407 Myc-DDK-tagged ORF clone of viral ORF for major capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042950
    • 10 ug

CNY 20,330.00

VC101408 Myc-DDK-tagged ORF clone of viral ORF for protein UL87 [Human herpesvirus 6], codon optimized for human cell expression, NP_042951
    • 10 ug

CNY 11,690.00

VC101409 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL88 [Human herpesvirus 6], codon optimized for human cell expression, NP_042952
    • 10 ug

CNY 4,180.00

VC101410 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042953
    • 10 ug

CNY 7,980.00

VC101411 Myc-DDK-tagged ORF clone of viral ORF for protein UL91 [Human herpesvirus 6], codon optimized for human cell expression, NP_042955
    • 10 ug

CNY 3,800.00

VC101412 Myc-DDK-tagged ORF clone of viral ORF for protein UL92 [Human herpesvirus 6], codon optimized for human cell expression, NP_042956
    • 10 ug

CNY 3,800.00

VC101413 Myc-DDK-tagged ORF clone of viral ORF for DNA packaging tegument protein UL17 [Human herpesvirus 6], codon optimized for human cell expression, NP_042957
    • 10 ug

CNY 5,420.00

VC101414 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL16 [Human herpesvirus 6], codon optimized for human cell expression, NP_042958
    • 10 ug

CNY 3,990.00

VC101415 Myc-DDK-tagged ORF clone of viral ORF for protein UL95 [Human herpesvirus 6], codon optimized for human cell expression, NP_042960
    • 10 ug

CNY 4,180.00

VC101416 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL14 [Human herpesvirus 6], codon optimized for human cell expression, NP_042961
    • 10 ug

CNY 3,800.00

VC101417 Myc-DDK-tagged ORF clone of viral ORF for tegument serine/threonine protein kinase [Human herpesvirus 6], codon optimized for human cell expression, NP_042962
    • 10 ug

CNY 6,750.00

VC101418 Myc-DDK-tagged ORF clone of viral ORF for deoxyribonuclease [Human herpesvirus 6], codon optimized for human cell expression, NP_042963
    • 10 ug

CNY 5,990.00

VC101419 Myc-DDK-tagged ORF clone of viral ORF for myristylated tegument protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042964
    • 10 ug

CNY 3,800.00

VC101420 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein M [Human herpesvirus 6], codon optimized for human cell expression, NP_042965
    • 10 ug

CNY 4,090.00

VC101421 Myc-DDK-tagged ORF clone of viral ORF for DNA replication origin-binding helicase [Human herpesvirus 6], codon optimized for human cell expression, NP_042966
    • 10 ug

CNY 11,880.00

VC101422 Myc-DDK-tagged ORF clone of viral ORF for helicase-primase subunit [Human herpesvirus 6], codon optimized for human cell expression, NP_042967
    • 10 ug

CNY 7,890.00

VC101423 Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL7 [Human herpesvirus 6], codon optimized for human cell expression, NP_042968
    • 10 ug

CNY 3,800.00

VC101424 Myc-DDK-tagged ORF clone of viral ORF for capsid portal protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042969
    • 10 ug

CNY 7,790.00

VC101425 Myc-DDK-tagged ORF clone of viral ORF for helicase-primase helicase subunit [Human herpesvirus 6], codon optimized for human cell expression, NP_042970
    • 10 ug

CNY 12,540.00

VC101426 Myc-DDK-tagged ORF clone of viral ORF for protein UL112 [Human herpesvirus 6], codon optimized for human cell expression, NP_042972
    • 10 ug

CNY 4,024.00

VC101427 Myc-DDK-tagged ORF clone of viral ORF for uracil-DNA glycosylase [Human herpesvirus 6], codon optimized for human cell expression, NP_042974
    • 10 ug

CNY 3,800.00

VC101428 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein L [Human herpesvirus 6], codon optimized for human cell expression, NP_042975
    • 10 ug

CNY 3,800.00

VC101429 Myc-DDK-tagged ORF clone of viral ORF for chemokine U83 [Human herpesvirus 6], codon optimized for human cell expression, NP_042976
    • 10 ug

CNY 3,800.00

VC101430 Myc-DDK-tagged ORF clone of viral ORF for protein UL117 [Human herpesvirus 6], codon optimized for human cell expression, NP_042977
    • 10 ug

CNY 4,090.00

VC101431 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL119 [Human herpesvirus 6], codon optimized for human cell expression, NP_042978
    • 10 ug

CNY 3,800.00

VC101433 Myc-DDK-tagged ORF clone of viral ORF for regulatory protein IE1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042983
    • 10 ug

CNY 14,160.00

VC101434 Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL124 [Human herpesvirus 6], codon optimized for human cell expression, NP_042984
    • 10 ug

CNY 1,320.00

VC101435 Myc-DDK-tagged ORF clone of viral ORF for protein U94/rep [Human herpesvirus 6], codon optimized for human cell expression, NP_042987
    • 10 ug

CNY 5,990.00

VC101436 Myc-DDK-tagged ORF clone of viral ORF for protein U95 [Human herpesvirus 6], codon optimized for human cell expression, NP_042988
    • 10 ug

CNY 16,910.00

VC101437 Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein Q [Human herpesvirus 6], codon optimized for human cell expression, NP_042993
    • 10 ug

CNY 7,890.00

VC101438 Myc-DDK-tagged ORF clone of viral ORF for protein DR1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042995
    • 10 ug

CNY 10,360.00

VC101439 Myc-DDK-tagged ORF clone of viral ORF for US22 family [Human herpesvirus 6], codon optimized for human cell expression, NP_043000
    • 10 ug

CNY 4,660.00

其它U38产品

Expression Plasmids
Lentiviral Particles
CRISPR
RNAi
Proteins
Antibodies
相关产品 (85)

VC101372

Myc-DDK-tagged ORF clone of viral ORF for protein U24A [Human herpesvirus 6], codon optimized for human cell expression, YP_002608174

    • 10 ug

CNY 3,800.00

VC101413

Myc-DDK-tagged ORF clone of viral ORF for DNA packaging tegument protein UL17 [Human herpesvirus 6], codon optimized for human cell expression, NP_042957

    • 10 ug

CNY 5,420.00

VC101371

Myc-DDK-tagged ORF clone of viral ORF for protein U24 [Human herpesvirus 6], codon optimized for human cell expression, NP_042917

    • 10 ug

CNY 3,800.00

VC101399

Myc-DDK-tagged ORF clone of viral ORF for DNA packaging tegument protein UL25 [Human herpesvirus 6], codon optimized for human cell expression, NP_042943

    • 10 ug

CNY 6,750.00

VC101367

Myc-DDK-tagged ORF clone of viral ORF for membrane protein U20 [Human herpesvirus 6], codon optimized for human cell expression, NP_042913

    • 10 ug

CNY 5,230.00

VC101401

Myc-DDK-tagged ORF clone of viral ORF for protein UL79 [Human herpesvirus 6], codon optimized for human cell expression, NP_042945

    • 10 ug

CNY 3,800.00

VC101438

Myc-DDK-tagged ORF clone of viral ORF for protein DR1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042995

    • 10 ug

CNY 10,360.00

VC101396

Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein 24 [Human herpesvirus 6], codon optimized for human cell expression, YP_002608175

    • 10 ug

CNY 3,800.00

VC101418

Myc-DDK-tagged ORF clone of viral ORF for deoxyribonuclease [Human herpesvirus 6], codon optimized for human cell expression, NP_042963

    • 10 ug

CNY 5,990.00

VC101363

Myc-DDK-tagged ORF clone of viral ORF for protein U15 [Human herpesvirus 6], codon optimized for human cell expression, NP_042907

    • 10 ug

CNY 3,800.00

VC101416

Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL14 [Human herpesvirus 6], codon optimized for human cell expression, NP_042961

    • 10 ug

CNY 3,800.00

VC101430

Myc-DDK-tagged ORF clone of viral ORF for protein UL117 [Human herpesvirus 6], codon optimized for human cell expression, NP_042977

    • 10 ug

CNY 4,090.00

VC101398

Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL24 [Human herpesvirus 6], codon optimized for human cell expression, NP_042942

    • 10 ug

CNY 3,800.00

VC101353

Myc-DDK-tagged ORF clone of viral ORF for protein DR6 [Human herpesvirus 6], codon optimized for human cell expression, NP_042888

    • 10 ug

CNY 4,660.00

VC101385

Myc-DDK-tagged ORF clone of viral ORF for nuclear egress lamina protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042930

    • 10 ug

CNY 3,800.00

VC101423

Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL7 [Human herpesvirus 6], codon optimized for human cell expression, NP_042968

    • 10 ug

CNY 3,800.00

VC101374

Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL43 [Human herpesvirus 6], codon optimized for human cell expression, NP_042919

    • 10 ug

CNY 3,800.00

VC101431

Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL119 [Human herpesvirus 6], codon optimized for human cell expression, NP_042978

    • 10 ug

CNY 3,800.00

VC101437

Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein Q [Human herpesvirus 6], codon optimized for human cell expression, NP_042993

    • 10 ug

CNY 7,890.00

VC101412

Myc-DDK-tagged ORF clone of viral ORF for protein UL92 [Human herpesvirus 6], codon optimized for human cell expression, NP_042956

    • 10 ug

CNY 3,800.00

VC101370

Myc-DDK-tagged ORF clone of viral ORF for membrane protein U23 [Human herpesvirus 6], codon optimized for human cell expression, NP_042916

    • 10 ug

CNY 3,800.00

VC101361

Myc-DDK-tagged ORF clone of viral ORF for protein U13 [Human herpesvirus 6], codon optimized for human cell expression, NP_042905

    • 10 ug

CNY 3,800.00

VC101383

Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL33 [Human herpesvirus 6], codon optimized for human cell expression, NP_042928

    • 10 ug

CNY 3,800.00

VC101422

Myc-DDK-tagged ORF clone of viral ORF for helicase-primase subunit [Human herpesvirus 6], codon optimized for human cell expression, NP_042967

    • 10 ug

CNY 7,890.00

VC101373

Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL43 [Human herpesvirus 6], codon optimized for human cell expression, NP_042918

    • 10 ug

CNY 3,800.00

VC101362

Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL35 [Human herpesvirus 6], codon optimized for human cell expression, NP_042906

    • 10 ug

CNY 7,320.00

VC101417

Myc-DDK-tagged ORF clone of viral ORF for tegument serine/threonine protein kinase [Human herpesvirus 6], codon optimized for human cell expression, NP_042962

    • 10 ug

CNY 6,750.00

VC101381

Myc-DDK-tagged ORF clone of viral ORF for protein UL49 [Human herpesvirus 6], codon optimized for human cell expression, NP_042926

    • 10 ug

CNY 5,700.00

VC101387

Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein B [Human herpesvirus 6], codon optimized for human cell expression, NP_042932

    • 10 ug

CNY 12,640.00

VC101384

Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL32 [Human herpesvirus 6], codon optimized for human cell expression, NP_042929

    • 10 ug

CNY 5,890.00

VC101409

Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL88 [Human herpesvirus 6], codon optimized for human cell expression, NP_042952

    • 10 ug

CNY 4,180.00

VC101369

Myc-DDK-tagged ORF clone of viral ORF for membrane protein U22 [Human herpesvirus 6], codon optimized for human cell expression, NP_042915

    • 10 ug

CNY 3,800.00

VC101380

Myc-DDK-tagged ORF clone of viral ORF for small capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042925

    • 10 ug

CNY 3,800.00

VC101354

Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL23 [Human herpesvirus 6], codon optimized for human cell expression, NP_042893

    • 10 ug

CNY 4,370.00

VC101389

Myc-DDK-tagged ORF clone of viral ORF for single-stranded DNA-binding protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042934

    • 10 ug

CNY 17,100.00

VC101427

Myc-DDK-tagged ORF clone of viral ORF for uracil-DNA glycosylase [Human herpesvirus 6], codon optimized for human cell expression, NP_042974

    • 10 ug

CNY 3,800.00

VC101411

Myc-DDK-tagged ORF clone of viral ORF for protein UL91 [Human herpesvirus 6], codon optimized for human cell expression, NP_042955

    • 10 ug

CNY 3,800.00

VC101382

Myc-DDK-tagged ORF clone of viral ORF for nuclear egress membrane protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042927

    • 10 ug

CNY 3,800.00

VC101424

Myc-DDK-tagged ORF clone of viral ORF for capsid portal protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042969

    • 10 ug

CNY 7,790.00

VC101366

Myc-DDK-tagged ORF clone of viral ORF for protein UL38 [Human herpesvirus 6], codon optimized for human cell expression, NP_042912

    • 10 ug

CNY 4,660.00

VC101414

Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL16 [Human herpesvirus 6], codon optimized for human cell expression, NP_042958

    • 10 ug

CNY 3,990.00

VC101358

Myc-DDK-tagged ORF clone of viral ORF for protein UL31 [Human herpesvirus 6], codon optimized for human cell expression, NP_042901

    • 10 ug

CNY 5,320.00

VC101397

Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein H [Human herpesvirus 6], codon optimized for human cell expression, NP_042941

    • 10 ug

CNY 10,450.00

VC101400

Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL78 [Human herpesvirus 6], codon optimized for human cell expression, NP_042944

    • 10 ug

CNY 3,800.00

VC101388

Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 2 [Human herpesvirus 6], codon optimized for human cell expression, NP_042933

    • 10 ug

CNY 10,930.00

VC101403

Myc-DDK-tagged ORF clone of viral ORF for capsid scaffold protein [Human herpesvirus 6], codon optimized for human cell expression, YP_002608176

    • 10 ug

CNY 3,800.00

VC101365

Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL37 [Human herpesvirus 6], codon optimized for human cell expression, NP_042911

    • 10 ug

CNY 3,800.00

VC101355

Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL24 [Human herpesvirus 6], codon optimized for human cell expression, NP_042894

    • 10 ug

CNY 4,470.00

VC101426

Myc-DDK-tagged ORF clone of viral ORF for protein UL112 [Human herpesvirus 6], codon optimized for human cell expression, NP_042972

    • 10 ug

CNY 4,024.00

VC101404

Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp65 [Human herpesvirus 6], codon optimized for human cell expression, NP_042947

    • 10 ug

CNY 4,024.00

VC101425

Myc-DDK-tagged ORF clone of viral ORF for helicase-primase helicase subunit [Human herpesvirus 6], codon optimized for human cell expression, NP_042970

    • 10 ug

CNY 12,540.00

VC101357

Myc-DDK-tagged ORF clone of viral ORF for protein UL28 [Human herpesvirus 6], codon optimized for human cell expression, NP_042898

    • 10 ug

CNY 18,620.00

VC101419

Myc-DDK-tagged ORF clone of viral ORF for myristylated tegument protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042964

    • 10 ug

CNY 3,800.00

VC101406

Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 2 [Human herpesvirus 6], codon optimized for human cell expression, NP_042949

    • 10 ug

CNY 3,800.00

VC101408

Myc-DDK-tagged ORF clone of viral ORF for protein UL87 [Human herpesvirus 6], codon optimized for human cell expression, NP_042951

    • 10 ug

CNY 11,690.00

VC101407

Myc-DDK-tagged ORF clone of viral ORF for major capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042950

    • 10 ug

CNY 20,330.00

VC101394

Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein N [Human herpesvirus 6], codon optimized for human cell expression, NP_042939

    • 10 ug

CNY 3,800.00

VC101420

Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein M [Human herpesvirus 6], codon optimized for human cell expression, NP_042965

    • 10 ug

CNY 4,090.00

VC101402

Myc-DDK-tagged ORF clone of viral ORF for capsid maturation protease [Human herpesvirus 6], codon optimized for human cell expression, NP_042946

    • 10 ug

CNY 6,370.00

VC101378

Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL37 [Human herpesvirus 6], codon optimized for human cell expression, NP_042923

    • 10 ug

CNY 14,060.00

VC101436

Myc-DDK-tagged ORF clone of viral ORF for protein U95 [Human herpesvirus 6], codon optimized for human cell expression, NP_042988

    • 10 ug

CNY 16,910.00

VC101368

Myc-DDK-tagged ORF clone of viral ORF for membrane protein U21 [Human herpesvirus 6], codon optimized for human cell expression, NP_042914

    • 10 ug

CNY 5,320.00

VC101392

Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL51 [Human herpesvirus 6], codon optimized for human cell expression, NP_042937

    • 10 ug

CNY 3,800.00

VC101391

Myc-DDK-tagged ORF clone of viral ORF for helicase-primase primase subunit [Human herpesvirus 6], codon optimized for human cell expression, NP_042936

    • 10 ug

CNY 13,020.00

VC101356

Myc-DDK-tagged ORF clone of viral ORF for protein UL27 [Human herpesvirus 6], codon optimized for human cell expression, NP_042895

    • 10 ug

CNY 6,460.00

VC101415

Myc-DDK-tagged ORF clone of viral ORF for protein UL95 [Human herpesvirus 6], codon optimized for human cell expression, NP_042960

    • 10 ug

CNY 4,180.00

VC101410

Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042953

    • 10 ug

CNY 7,980.00

VC101375

Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase processivity subunit [Human herpesvirus 6], codon optimized for human cell expression, NP_042920

    • 10 ug

CNY 4,370.00

VC101393

Myc-DDK-tagged ORF clone of viral ORF for deoxyuridine triphosphatase [Human herpesvirus 6], codon optimized for human cell expression, NP_042938

    • 10 ug

CNY 4,470.00

VC101435

Myc-DDK-tagged ORF clone of viral ORF for protein U94/rep [Human herpesvirus 6], codon optimized for human cell expression, NP_042987

    • 10 ug

CNY 5,990.00

VC101377

Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042922

    • 10 ug

CNY 3,800.00

VC101429

Myc-DDK-tagged ORF clone of viral ORF for chemokine U83 [Human herpesvirus 6], codon optimized for human cell expression, NP_042976

    • 10 ug

CNY 3,800.00

VC101376

Myc-DDK-tagged ORF clone of viral ORF for ribonucleotide reductase subunit 1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042921

    • 10 ug

CNY 12,260.00

VC101433

Myc-DDK-tagged ORF clone of viral ORF for regulatory protein IE1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042983

    • 10 ug

CNY 14,160.00

VC101390

Myc-DDK-tagged ORF clone of viral ORF for multifunctional expression regulator [Human herpesvirus 6], codon optimized for human cell expression, NP_042935

    • 10 ug

CNY 6,270.00

VC101352

Myc-DDK-tagged ORF clone of viral ORF for protein DR1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042883

    • 10 ug

CNY 10,360.00

VC101359

Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp150 [Human herpesvirus 6], codon optimized for human cell expression, NP_042902

    • 10 ug

CNY 13,210.00

VC101428

Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein L [Human herpesvirus 6], codon optimized for human cell expression, NP_042975

    • 10 ug

CNY 3,800.00

VC101360

Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL33 [Human herpesvirus 6], codon optimized for human cell expression, NP_042903

    • 10 ug

CNY 4,180.00

VC101395

Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein O [Human herpesvirus 6], codon optimized for human cell expression, NP_042940

    • 10 ug

CNY 7,410.00

VC101364

Myc-DDK-tagged ORF clone of viral ORF for tegument protein vICA [Human herpesvirus 6], codon optimized for human cell expression, NP_042910

    • 10 ug

CNY 3,990.00

VC101434

Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL124 [Human herpesvirus 6], codon optimized for human cell expression, NP_042984

    • 10 ug

CNY 1,320.00

VC101405

Myc-DDK-tagged ORF clone of viral ORF for protein UL84 [Human herpesvirus 6], codon optimized for human cell expression, NP_042948

    • 10 ug

CNY 5,320.00

VC101439

Myc-DDK-tagged ORF clone of viral ORF for US22 family [Human herpesvirus 6], codon optimized for human cell expression, NP_043000

    • 10 ug

CNY 4,660.00

VC101421

Myc-DDK-tagged ORF clone of viral ORF for DNA replication origin-binding helicase [Human herpesvirus 6], codon optimized for human cell expression, NP_042966

    • 10 ug

CNY 11,880.00

Previous
Next
Customer Reviews