UL22A (NC_006273) Virus Tagged ORF Clone

CAT#: VC101213

  • TrueORF®

Myc-DDK-tagged ORF clone of viral ORF for glycoprotein UL22A [Human herpesvirus 5], codon optimized for human cell expression, YP_081481



  View other clones from "Virus" (142)

Need custom modification / cloning service?
Get a free quote

CNY 3,800.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Type Virus Tagged ORF Clone
Tag Myc-DDK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>The Viral ORF clone VC101213 represents NCBI reference of YP_081481 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCGCCGGCTGTGGATTCTGAGCCTTCTGGCCGTCACGCTGACTGTGGCCTTGGCAGCACCCTCTC
AGAAGTCAAAAAGGTCAGTCACAGTCGAGCAGCCCTCTACATCAACCAATTCCGACGGCAATACCACTCC
CTCTAAAAACGTTACATTGAGCCAGGGCGGCAGTACTACTGACGGTGATGAGGATTATTCTGGAGGCGAT
TACGATGTGCTGATTACTGATACTGACGGCGGGAACCACCAGCAGCCACAAGAGAAGACTGATGAGCACA
AAGGGGAACACACTAAGGAAAATGAGAAAACTCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>VC101213 representing YP_081481
Red=Cloning sites Green=Tags

MARRLWILSLLAVTLTVALAAPSQKSKRSVTVEQPSTSTNSDGNTTPSKNVTLSQGGSTTDGDEDYSGGD
YDVLITDTDGGNHQQPQEKTDEHKGEHTKENEKTQ

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
ACCN NC_006273
ORF Size 315 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NC_006273.2, YP_081481
RefSeq ORF 315 bp
Locus ID 3077571
MW 11.3 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...