BARF1 (NC_007605) Virus Tagged ORF Clone
CAT#: VC101179
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for BARF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401719
View other clones from "Virus" (71)
Need custom modification / cloning service?
Get a free quote
CN¥ 3,800.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC101179 represents NCBI reference of YP_401719 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCAGGTTCATCGCACAGCTGCTGCTGTTGGCTTCATGCGTCGCGGCGGGCCAGGCAGTTACCGCTT TTCTCGGTGAAAGAGTAACATTGACAAGCTATTGGAGGAGAGTGTCATTGGGACCGGAGATCGAGGTCTC CTGGTTCAAACTTGGACCCGGCGAGGAACAGGTTCTCATTGGGAGAATGCACCATGACGTAATCTTCATC GAATGGCCATTCAGGGGGTTCTTCGATATCCACCGGAGTGCTAACACCTTTTTTCTCGTGGTGACCGCCG CCAATATTTCACACGACGGGAATTATCTGTGCCGAATGAAGCTCGGTGAGACCGAGGTGACGAAACAAGA GCATCTGTCCGTAGTGAAGCCATTGACTCTTTCCGTACACTCAGAACGGTCTCAATTCCCCGATTTCAGC GTGCTCACTGTAACATGCACCGTAAACGCCTTCCCCCATCCGCATGTTCAGTGGCTGATGCCCGAAGGTG TCGAACCTGCCCCGACGGCTGCTAATGGTGGAGTGATGAAGGAGAAGGATGGCTCCCTCAGCGTTGCCGT GGATCTCAGCCTTCCCAAACCATGGCATCTGCCTGTGACCTGCGTGGGCAAAAACGACAAAGAGGAGGCT CATGGCGTGTATGTCTCAGGATACCTGTCTCAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101179 representing YP_401719
Red=Cloning sites Green=Tags MARFIAQLLLLASCVAAGQAVTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFI EWPFRGFFDIHRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFS VLTVTCTVNAFPHPHVQWLMPEGVEPAPTAANGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEA HGVYVSGYLSQ TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_007605 |
ORF Size | 663 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NC_007605.1, YP_401719 |
RefSeq ORF | 663 bp |
Locus ID | 3783772 |
UniProt ID | P03211 |
MW | 24.5 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC101093 | Myc-DDK-tagged ORF clone of viral ORF for K15 [Human herpesvirus 4], codon optimized for human cell expression, YP_401631 |
CN¥ 5,488.00 |
|
VC101094 | Myc-DDK-tagged ORF clone of viral ORF for LMP-2B [Human herpesvirus 4], codon optimized for human cell expression, YP_401632 |
CN¥ 5,488.00 |
|
VC101095 | Myc-DDK-tagged ORF clone of viral ORF for BNRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401633 |
CN¥ 19,950.00 |
|
VC101096 | Myc-DDK-tagged ORF clone of viral ORF for BCRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401634 |
CN¥ 3,800.00 |
|
VC101108 | Myc-DDK-tagged ORF clone of viral ORF for BHRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401646 |
CN¥ 2,400.00 |
|
VC101109 | Myc-DDK-tagged ORF clone of viral ORF for BFLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401647 |
CN¥ 3,800.00 |
|
VC101110 | Myc-DDK-tagged ORF clone of viral ORF for BFLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401648 |
CN¥ 6,370.00 |
|
VC101111 | Myc-DDK-tagged ORF clone of viral ORF for BFRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401649 |
CN¥ 3,990.00 |
|
VC101112 | Myc-DDK-tagged ORF clone of viral ORF for BFRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401650 |
CN¥ 6,600.00 |
|
VC101116 | Myc-DDK-tagged ORF clone of viral ORF for BORF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401654 |
CN¥ 4,370.00 |
|
VC101117 | Myc-DDK-tagged ORF clone of viral ORF for BORF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401655 |
CN¥ 12,540.00 |
|
VC101118 | Myc-DDK-tagged ORF clone of viral ORF for BaRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401656 |
CN¥ 3,800.00 |
|
VC101119 | Myc-DDK-tagged ORF clone of viral ORF for BMRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401657 |
CN¥ 5,488.00 |
|
VC101120 | Myc-DDK-tagged ORF clone of viral ORF for BMRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401658 |
CN¥ 4,280.00 |
|
VC101121 | Myc-DDK-tagged ORF clone of viral ORF for BSLF2/BMLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401659 |
CN¥ 4,024.00 |
|
VC101122 | Myc-DDK-tagged ORF clone of viral ORF for BSLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401662 |
CN¥ 13,210.00 |
|
VC101123 | Myc-DDK-tagged ORF clone of viral ORF for BSRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401663 |
CN¥ 3,800.00 |
|
VC101124 | Myc-DDK-tagged ORF clone of viral ORF for BLLF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401664 |
CN¥ 3,800.00 |
|
VC101125 | Myc-DDK-tagged ORF clone of viral ORF for BLRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401665 |
CN¥ 3,800.00 |
|
VC101126 | Myc-DDK-tagged ORF clone of viral ORF for BLRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401666 |
CN¥ 3,800.00 |
|
VC101128 | Myc-DDK-tagged ORF clone of viral ORF for BLLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401668 |
CN¥ 3,800.00 |
|
VC101132 | Myc-DDK-tagged ORF clone of viral ORF for BZLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401672 |
CN¥ 3,800.00 |
|
VC101133 | Myc-DDK-tagged ORF clone of viral ORF for BZLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401673 |
CN¥ 3,600.00 |
|
VC101134 | Myc-DDK-tagged ORF clone of viral ORF for BRLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401674 |
CN¥ 7,320.00 |
|
VC101135 | Myc-DDK-tagged ORF clone of viral ORF for BRRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401675 |
CN¥ 3,800.00 |
|
VC101136 | Myc-DDK-tagged ORF clone of viral ORF for BRRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401676 |
CN¥ 6,460.00 |
|
VC101138 | Myc-DDK-tagged ORF clone of viral ORF for BKRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401678 |
CN¥ 3,800.00 |
|
VC101139 | Myc-DDK-tagged ORF clone of viral ORF for BKRF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401679. Note: ORF is codon optimized |
CN¥ 2,640.00 |
|
VC101140 | Myc-DDK-tagged ORF clone of viral ORF for BKRF4 [Human herpesvirus 4], codon optimized for human cell expression, YP_401680 |
CN¥ 3,800.00 |
|
VC101141 | Myc-DDK-tagged ORF clone of viral ORF for BBLF4 [Human herpesvirus 4], codon optimized for human cell expression, YP_401681 |
CN¥ 12,260.00 |
|
VC101142 | Myc-DDK-tagged ORF clone of viral ORF for BBRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401682 |
CN¥ 7,410.00 |
|
VC101143 | Myc-DDK-tagged ORF clone of viral ORF for BBRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401683 |
CN¥ 3,800.00 |
|
VC101144 | Myc-DDK-tagged ORF clone of viral ORF for BBLF2/BBLF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401684 |
CN¥ 10,640.00 |
|
VC101145 | Myc-DDK-tagged ORF clone of viral ORF for BBRF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401685 |
CN¥ 4,940.00 |
|
VC101146 | Myc-DDK-tagged ORF clone of viral ORF for BBLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401686 |
CN¥ 3,800.00 |
|
VC101147 | Myc-DDK-tagged ORF clone of viral ORF for BGLF5 [Human herpesvirus 4], codon optimized for human cell expression, YP_401687 |
CN¥ 5,700.00 |
|
VC101148 | Myc-DDK-tagged ORF clone of viral ORF for BGLF4 [Human herpesvirus 4], codon optimized for human cell expression, YP_401688 |
CN¥ 5,230.00 |
|
VC101149 | Myc-DDK-tagged ORF clone of viral ORF for BGLF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401689 |
CN¥ 3,800.00 |
|
VC101150 | Myc-DDK-tagged ORF clone of viral ORF for BGRF1/BDRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401690 |
CN¥ 10,450.00 |
|
VC101151 | Myc-DDK-tagged ORF clone of viral ORF for BGLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401691 |
CN¥ 3,990.00 |
|
VC101152 | Myc-DDK-tagged ORF clone of viral ORF for BGLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401692 |
CN¥ 6,180.00 |
|
VC101153 | Myc-DDK-tagged ORF clone of viral ORF for BDLF4 [Human herpesvirus 4], codon optimized for human cell expression, YP_401693 |
CN¥ 3,800.00 |
|
VC101154 | Myc-DDK-tagged ORF clone of viral ORF for BDLF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401694 |
CN¥ 3,800.00 |
|
VC101155 | Myc-DDK-tagged ORF clone of viral ORF for BDLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401695 |
CN¥ 5,130.00 |
|
VC101156 | Myc-DDK-tagged ORF clone of viral ORF for BDLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401696 |
CN¥ 3,800.00 |
|
VC101157 | Myc-DDK-tagged ORF clone of viral ORF for BcLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401697 |
CN¥ 20,810.00 |
|
VC101158 | Myc-DDK-tagged ORF clone of viral ORF for BcRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401698 |
CN¥ 8,240.00 |
|
VC101159 | Myc-DDK-tagged ORF clone of viral ORF for BTRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401699 |
CN¥ 4,750.00 |
|
VC101160 | Myc-DDK-tagged ORF clone of viral ORF for BXLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401700 |
CN¥ 10,640.00 |
|
VC101161 | Myc-DDK-tagged ORF clone of viral ORF for BXLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401701 |
CN¥ 7,320.00 |
|
VC101162 | Myc-DDK-tagged ORF clone of viral ORF for BXRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401702 |
CN¥ 3,800.00 |
|
VC101163 | Myc-DDK-tagged ORF clone of viral ORF for BVRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401703 |
CN¥ 6,840.00 |
|
VC101164 | Myc-DDK-tagged ORF clone of viral ORF for BVRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401704 |
CN¥ 7,320.00 |
|
VC101165 | Myc-DDK-tagged ORF clone of viral ORF for BdRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401705 |
CN¥ 5,488.00 |
|
VC101166 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein [Human herpesvirus 4], codon optimized for human cell expression, YP_401706 |
CN¥ 3,800.00 |
|
VC101168 | Myc-DDK-tagged ORF clone of viral ORF for LF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401708 |
CN¥ 5,230.00 |
|
VC101169 | Myc-DDK-tagged ORF clone of viral ORF for LF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401709 |
CN¥ 5,700.00 |
|
VC101170 | Myc-DDK-tagged ORF clone of viral ORF for RPMS1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401710 |
CN¥ 3,800.00 |
|
VC101171 | Myc-DDK-tagged ORF clone of viral ORF for BILF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401711 |
CN¥ 3,600.00 |
|
VC101172 | Myc-DDK-tagged ORF clone of viral ORF for BALF5 [Human herpesvirus 4], codon optimized for human cell expression, YP_401712 |
CN¥ 15,390.00 |
|
VC101173 | Myc-DDK-tagged ORF clone of viral ORF for BALF4 [Human herpesvirus 4], codon optimized for human cell expression, YP_401713 |
CN¥ 13,020.00 |
|
VC101174 | Myc-DDK-tagged ORF clone of viral ORF for A73 [Human herpesvirus 4], codon optimized for human cell expression, YP_401714 |
CN¥ 3,800.00 |
|
VC101175 | Myc-DDK-tagged ORF clone of viral ORF for BALF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401715 |
CN¥ 10,360.00 |
|
VC101177 | Myc-DDK-tagged ORF clone of viral ORF for BALF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401717 |
CN¥ 17,010.00 |
|
VC101178 | Myc-DDK-tagged ORF clone of viral ORF for BALF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401718 |
CN¥ 3,800.00 |
|
VC101180 | Myc-DDK-tagged ORF clone of viral ORF for BNLF2b [Human herpesvirus 4], codon optimized for human cell expression, YP_401720 |
CN¥ 3,800.00 |
|
VC101181 | Myc-DDK-tagged ORF clone of viral ORF for BNLF2a [Human herpesvirus 4], codon optimized for human cell expression, YP_401721 |
CN¥ 3,800.00 |
|
VC101183 | Myc-DDK-tagged ORF clone of viral ORF for BFRF1A [Human herpesvirus 4], codon optimized for human cell expression, YP_401728 |
CN¥ 3,800.00 |
|
VC101184 | Myc-DDK-tagged ORF clone of viral ORF for BGLF35 [Human herpesvirus 4], codon optimized for human cell expression, YP_401724 |
CN¥ 1,800.00 |
|
VC101185 | Myc-DDK-tagged ORF clone of viral ORF for BDLF35 [Human herpesvirus 4], codon optimized for human cell expression, YP_401725 |
CN¥ 1,920.00 |
|
VC101186 | Myc-DDK-tagged ORF clone of viral ORF for BVLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401726 |
CN¥ 3,800.00 |