CSEN (KCNIP3) (NM_001034914) Human Recombinant Protein
CAT#: TP324492
Recombinant protein of human Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 2, 20 µg
View other "CSEN" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224492 representing NM_001034914
Red=Cloning site Green=Tags(s) MGIQGMELCAMAVVVLLFIAVLKQFGILEPISMEDSSDSELELSTVRHQPEGLDQLQAQTKFTKKELQSL YRGFKNECPTGLVDEDTFKLIYAQFFPQGDATTYAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEK LKWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRHTYPILREDAPAEHVERFFEKMDRNQDGVVTIEEFL EACQKDENIMSSMQLFENVI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001030086 |
Locus ID | 30818 |
UniProt ID | Q9Y2W7 |
Refseq Size | 2735 |
Cytogenetics | 2q11.1 |
Refseq ORF | 690 |
Synonyms | CSEN; DREAM; KCHIP3 |
Summary | This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of this family are small calcium binding proteins containing EF-hand-like domains. They are integral subunit components of native Kv4 channel complexes that may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. The encoded protein also functions as a calcium-regulated transcriptional repressor, and interacts with presenilins. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415545 | KCNIP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422112 | KCNIP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415545 | Transient overexpression lysate of Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 1 |
CNY 3,080.00 |
|
LY422112 | Transient overexpression lysate of Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 2 |
CNY 3,080.00 |
|
PH303957 | KCNIP3 MS Standard C13 and N15-labeled recombinant protein (NP_038462) |
CNY 19,520.00 |
|
PH324492 | KCNIP3 MS Standard C13 and N15-labeled recombinant protein (NP_001030086) |
CNY 19,520.00 |
|
TP303957 | Recombinant protein of human Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 1, 20 µg |
CNY 2,900.00 |