CSEN (KCNIP3) (NM_013434) Human Mass Spec Standard
CAT#: PH303957
KCNIP3 MS Standard C13 and N15-labeled recombinant protein (NP_038462)
View other "CSEN" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | KCNIP3 MS Standard C13 and N15-labeled recombinant protein (NP_038462) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203957 |
Predicted MW | 29.2 kDa |
Protein Sequence |
>RC203957 protein sequence
Red=Cloning site Green=Tags(s) MQPAKEVTKASDGSLLGDLGHTPLSKKEGIKWQRPRLSRQALMRCCLVKWILSSTAPQGSDSSDSELELS TVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYAQFFPQGDATTYAHFLFNAFDA DGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRHTYPILREDA PAEHVERFFEKMDRNQDGVVTIEEFLEACQKDENIMSSMQLFENVI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_038462 |
RefSeq Size | 2928 |
RefSeq ORF | 768 |
Synonyms | CSEN; DREAM; KCHIP3 |
Locus ID | 30818 |
Cytogenetics | 2q11.1 |
Summary | This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of this family are small calcium binding proteins containing EF-hand-like domains. They are integral subunit components of native Kv4 channel complexes that may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. The encoded protein also functions as a calcium-regulated transcriptional repressor, and interacts with presenilins. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415545 | KCNIP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422112 | KCNIP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415545 | Transient overexpression lysate of Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 1 |
CNY 3,080.00 |
|
LY422112 | Transient overexpression lysate of Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 2 |
CNY 3,080.00 |
|
PH324492 | KCNIP3 MS Standard C13 and N15-labeled recombinant protein (NP_001030086) |
CNY 19,520.00 |
|
TP303957 | Recombinant protein of human Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP324492 | Recombinant protein of human Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 2, 20 µg |
CNY 2,900.00 |