United States
Germany
Japan
United Kingdom
China
MBNL1 (NM_207296) Human Recombinant Protein
CAT＃: TP323216
Recombinant protein of human muscleblind-like (Drosophila) (MBNL1), transcript variant 6, 20 µg
View other "MBNL1" proteins (23)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
| Cited in 1 publication. |
Product images
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223216 representing NM_207296
Red=Cloning site Green=Tags(s) MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLH PPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPV SPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTM IDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMFPWCTVLRQPL CPQQQHLPQVFPSLQQPQPTSPILDASTLLGATSCPAAAGKMIPIISAEHLTSHKYVTQM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 36.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | MBNL1 Activity Verified in an mRNA Splicing Assay: MBNL1 (TP323216) activity was measured in an mRNA splicing assay. RNA containing insulin receptor (IR) alternative exon 11 flanked by heterologous exons was prepared from template DNA by in vitro transcription. The RNA was incubated with 0.1 or 0.2 micrograms of MBNL1 under splicing conditions for 0 or 2 hours. As a negative control, reactions were carried out in the absence of ATP. RNA was purified from the splicing reactions and used as a template for reverse transcriptase PCR (RT-PCR) using primers in the flanking exons. PCR products were run on a 5% acrylamide gel and stained with ethidium bromide. Band intensity was measured by densitometry and the identity of the indicated products was verified by sequencing. (Data courtesy of Tom Cooper’s laboratory at the Baylor College of Medicine). |
| Reference Data | |
| RefSeq | NP_997179 |
| Locus ID | 4154 |
| UniProt ID | Q9NR56 |
| Refseq Size | 5246 |
| Cytogenetics | 3q25.1-q25.2 |
| Refseq ORF | 1020 |
| Synonyms | EXP; MBNL |
| Summary | This gene encodes a member of the muscleblind protein family which was initially described in Drosophila melanogaster. The encoded protein is a C3H-type zinc finger protein that modulates alternative splicing of pre-mRNAs. Muscleblind proteins bind specifically to expanded dsCUG RNA but not to normal size CUG repeats and may thereby play a role in the pathophysiology of myotonic dystrophy. Mice lacking this gene exhibited muscle abnormalities and cataracts. Several alternatively spliced transcript variants have been described but the full-length natures of only some have been determined. The different isoforms are thought to have different binding specificities and/or splicing activities. [provided by RefSeq, Sep 2015] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Muscleblind-like 1 activates insulin receptor exon 11 inclusion by enhancing U2AF65 binding and splicing of the upstream intron
,Echeverria, GV;Cooper, TA;,
J. Cell Sci., Aug 2013; 126: 3782 - 3795.
,PubMed ID 24185704
[MBNL1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402822 | MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404075 | MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404076 | MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404077 | MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404078 | MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404079 | MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404080 | MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402822 | Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 1 |
CNY 3,080.00 |
|
| LY404075 | Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 2 |
CNY 3,080.00 |
|
| LY404076 | Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 3 |
CNY 3,080.00 |
|
| LY404077 | Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 4 |
CNY 3,080.00 |
|
| LY404078 | Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 5 |
CNY 3,080.00 |
|
| LY404079 | Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 6 |
CNY 3,080.00 |
|
| LY404080 | Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 7 |
CNY 3,080.00 |
|
| PH308112 | MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_066368) |
CNY 19,520.00 |
|
| PH319704 | MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_997178) |
CNY 14,250.00 |
|
| PH323104 | MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_997176) |
CNY 14,250.00 |
|
| PH323199 | MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_997180) |
CNY 14,250.00 |
|
| PH323216 | MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_997179) |
CNY 19,520.00 |
|
| TP308112 | Recombinant protein of human muscleblind-like (Drosophila) (MBNL1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP319704 | Recombinant protein of human muscleblind-like (Drosophila) (MBNL1), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
| TP323104 | Purified recombinant protein of Homo sapiens muscleblind-like (Drosophila) (MBNL1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP323199 | Purified recombinant protein of Homo sapiens muscleblind-like (Drosophila) (MBNL1), transcript variant 7, 20 µg |
CNY 2,900.00 |
