MBNL1 (NM_207295) Human Recombinant Protein
CAT#: TP319704
Recombinant protein of human muscleblind-like (Drosophila) (MBNL1), transcript variant 5, 20 µg
View other "MBNL1" proteins (23)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219704 representing NM_207295
Red=Cloning site Green=Tags(s) MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLH PPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVVCREYQRGNCNRGENDCRFAHPADS TMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMGIPQAVLPP LPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAAT TSATSVPFAATATANQIPIISAEHLTSHKYVTQM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_997178 |
Locus ID | 4154 |
UniProt ID | Q9NR56 |
Refseq Size | 5168 |
Cytogenetics | 3q25.1-q25.2 |
Refseq ORF | 942 |
Synonyms | EXP; MBNL |
Summary | This gene encodes a member of the muscleblind protein family which was initially described in Drosophila melanogaster. The encoded protein is a C3H-type zinc finger protein that modulates alternative splicing of pre-mRNAs. Muscleblind proteins bind specifically to expanded dsCUG RNA but not to normal size CUG repeats and may thereby play a role in the pathophysiology of myotonic dystrophy. Mice lacking this gene exhibited muscle abnormalities and cataracts. Several alternatively spliced transcript variants have been described but the full-length natures of only some have been determined. The different isoforms are thought to have different binding specificities and/or splicing activities. [provided by RefSeq, Sep 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402822 | MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC404075 | MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC404076 | MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC404077 | MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC404078 | MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC404079 | MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC404080 | MBNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY402822 | Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 1 |
CN¥ 3,080.00 |
|
LY404075 | Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 2 |
CN¥ 3,080.00 |
|
LY404076 | Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 3 |
CN¥ 3,080.00 |
|
LY404077 | Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 4 |
CN¥ 3,080.00 |
|
LY404078 | Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 5 |
CN¥ 3,080.00 |
|
LY404079 | Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 6 |
CN¥ 3,080.00 |
|
LY404080 | Transient overexpression lysate of muscleblind-like (Drosophila) (MBNL1), transcript variant 7 |
CN¥ 3,080.00 |
|
PH308112 | MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_066368) |
CN¥ 19,520.00 |
|
PH319704 | MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_997178) |
CN¥ 14,250.00 |
|
PH323104 | MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_997176) |
CN¥ 14,250.00 |
|
PH323199 | MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_997180) |
CN¥ 14,250.00 |
|
PH323216 | MBNL1 MS Standard C13 and N15-labeled recombinant protein (NP_997179) |
CN¥ 19,520.00 |
|
TP308112 | Recombinant protein of human muscleblind-like (Drosophila) (MBNL1), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP323104 | Purified recombinant protein of Homo sapiens muscleblind-like (Drosophila) (MBNL1), transcript variant 3, 20 µg |
CN¥ 2,900.00 |
|
TP323199 | Purified recombinant protein of Homo sapiens muscleblind-like (Drosophila) (MBNL1), transcript variant 7, 20 µg |
CN¥ 2,900.00 |
|
TP323216 | Recombinant protein of human muscleblind-like (Drosophila) (MBNL1), transcript variant 6, 20 µg |
CN¥ 2,900.00 |