MBNL1 (NM_207296) Human Recombinant Protein

Specifications

Product Data
Species	Human
Expression Host	HEK293T
Expression cDNA Clone or AA Sequence	Protein Sequence (showhide) >RC223216 representing NM_207296 Red=Cloning site Green=Tags(s) MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLH PPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPV SPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTM IDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMFPWCTVLRQPL CPQQQHLPQVFPSLQQPQPTSPILDASTLLGATSCPAAAGKMIPIISAEHLTSHKYVTQM myc-FLAG tag
Tag	C-Myc/DDK
Predicted MW	36.8 kDa
Concentration	>0.05 µg/µL as determined by microplate BCA method
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer	25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation	Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note	For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage	Store at -80°C.
Stability	Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Bioactivity	MBNL1 Activity Verified in an mRNA Splicing Assay: MBNL1 (TP323216) activity was measured in an mRNA splicing assay. RNA containing insulin receptor (IR) alternative exon 11 flanked by heterologous exons was prepared from template DNA by in vitro transcription. The RNA was incubated with 0.1 or 0.2 micrograms of MBNL1 under splicing conditions for 0 or 2 hours. As a negative control, reactions were carried out in the absence of ATP. RNA was purified from the splicing reactions and used as a template for reverse transcriptase PCR (RT-PCR) using primers in the flanking exons. PCR products were run on a 5% acrylamide gel and stained with ethidium bromide. Band intensity was measured by densitometry and the identity of the indicated products was verified by sequencing. (Data courtesy of Tom Cooper’s laboratory at the Baylor College of Medicine).
Reference Data
RefSeq	NP_997179
Locus ID	4154
UniProt ID	Q9NR56
Refseq Size	5246
Cytogenetics	3q25.1-q25.2
Refseq ORF	1020
Synonyms	EXP; MBNL
Summary	This gene encodes a member of the muscleblind protein family which was initially described in Drosophila melanogaster. The encoded protein is a C3H-type zinc finger protein that modulates alternative splicing of pre-mRNAs. Muscleblind proteins bind specifically to expanded dsCUG RNA but not to normal size CUG repeats and may thereby play a role in the pathophysiology of myotonic dystrophy. Mice lacking this gene exhibited muscle abnormalities and cataracts. Several alternatively spliced transcript variants have been described but the full-length natures of only some have been determined. The different isoforms are thought to have different binding specificities and/or splicing activities. [provided by RefSeq, Sep 2015]

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.