MBNL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MBNL1 antibody: synthetic peptide directed towards the middle region of human MBNL1. Synthetic peptide located within the following region: AMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	muscleblind like splicing regulator 1
Database Link	NP_066368 Entrez Gene 4154 Human UniProt ID Q9NR56
Background	MBNL1 contains 4 C3H1-type zinc fingers and binds to CUG triplet repeat expansion dsRNA.
Synonyms	EXP; EXP35; EXP40; EXP42; MBNL
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Zebrafish: 100%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.