Ceramide glucosyltransferase (UGCG) (NM_003358) Human Recombinant Protein
CAT#: TP306288
Recombinant protein of human UDP-glucose ceramide glucosyltransferase (UGCG), 20 µg
View other "Ceramide glucosyltransferase" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206288 protein sequence
Red=Cloning site Green=Tags(s) MALLDLALEGMAVFGFVLFLVLWLMHFMAIIYTRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNL ETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPGYEVAKYDLI WICDSGIRVIPDTLTDMVNQMTEKVGLVHGLPYVADRQGFAATLEQVYFGTSHPRYYISANVTGFKCVTG MSCLMRKDVLDQAGGLIAFAQYIAEDYFMAKAIADRGWRFAMSTQVAMQNSGSYSISQFQSRMIRWTKLR INMLPATIICEPISECFVASLIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGTLCFSKLDYA VAWFIRESMTIYIFLSALWDPTISWRTGRYRLRCGGTAEEILDV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003349 |
Locus ID | 7357 |
UniProt ID | Q16739 |
Refseq Size | 1637 |
Cytogenetics | 9q31.3 |
Refseq ORF | 1182 |
Synonyms | GCS; GLCT1 |
Summary | This gene encodes an enzyme that catalyzes the first glycosylation step in the biosynthesis of glycosphingolipids, which are membrane components containing lipid and sugar moieties. The product of this reaction is glucosylceramide, which is the core structure of many glycosphingolipids. [provided by RefSeq, Dec 2014] |
Protein Families | Transmembrane |
Protein Pathways | Metabolic pathways, Sphingolipid metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401148 | UGCG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401148 | Transient overexpression lysate of UDP-glucose ceramide glucosyltransferase (UGCG) |
CNY 3,080.00 |
|
PH306288 | UGCG MS Standard C13 and N15-labeled recombinant protein (NP_003349) |
CNY 19,520.00 |
其它Ceramide glucosyltransferase产品