Ceramide glucosyltransferase (UGCG) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-UGCG antibody: synthetic peptide directed towards the N terminal of human UGCG. Synthetic peptide located within the following region: LHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	UDP-glucose ceramide glucosyltransferase
Database Link	NP_003349 Entrez Gene 7357 Human UniProt ID Q16739
Background	Glycosphingolipids (GSLs) are a group of membrane components that contain lipid and sugar moieties. They are present in essentially all animal cells and are believed to have important roles in various cellular processes. UDP-glucose ceramide glucosyltrans
Synonyms	GCS; GLCT1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 77%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Metabolic pathways, Sphingolipid metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.