Serum Amyloid A (SAA1) (NM_000331) Human Mass Spec Standard
CAT#: PH310664
SAA1 MS Standard C13 and N15-labeled recombinant protein (NP_000322)
View other "Serum Amyloid A" proteins (9)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | SAA1 MS Standard C13 and N15-labeled recombinant protein (NP_000322) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210664 |
Predicted MW | 13.5 kDa |
Protein Sequence |
>RC210664 protein sequence
Red=Cloning site Green=Tags(s) MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGV WAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000322 |
RefSeq Size | 678 |
RefSeq ORF | 366 |
Synonyms | PIG4; SAA; SAA2; TP53I4 |
Locus ID | 6288 |
Cytogenetics | 11p15.1 |
Summary | This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Finally, antimicrobial activity against S. aureus and E. coli resides in the N-terminal portion of the mature protein. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11. [provided by RefSeq, Jul 2020] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403693 | SAA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC424788 | SAA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY403693 | Transient overexpression lysate of serum amyloid A1 (SAA1), transcript variant 2 |
CN¥ 3,080.00 |
|
LY424788 | Transient overexpression lysate of serum amyloid A1 (SAA1), transcript variant 1 |
CN¥ 3,080.00 |
|
PH302738 | SAA1 MS Standard C13 and N15-labeled recombinant protein (NP_954630) |
CN¥ 19,520.00 |
|
TP302738 | Recombinant protein of human serum amyloid A1 (SAA1), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP310664 | Recombinant protein of human serum amyloid A1 (SAA1), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP750173 | Purified recombinant protein of Human serum amyloid A1 (SAA1), transcript variant 1, 19Arg-End, with N-terminal HIS tag, expressed in E.Coli, 50 ug |
CN¥ 2,040.00 |
|
TP762437 | Purified recombinant protein of Human serum amyloid A1 (SAA1), transcript variant 2, Arg19-End, with N-terminal His tag, expressed in E.coli, 50ug |
CN¥ 1,950.00 |
其它Serum Amyloid A产品