Serum Amyloid A (SAA1) (NM_199161) Human Recombinant Protein
CAT#: TP302738
Recombinant protein of human serum amyloid A1 (SAA1), transcript variant 2, 20 µg
View other "Serum Amyloid A" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202738 protein sequence
Red=Cloning site Green=Tags(s) MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGV WAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_954630 |
Locus ID | 6288 |
UniProt ID | P0DJI8 |
Refseq Size | 531 |
Cytogenetics | 11p15.1 |
Refseq ORF | 366 |
Synonyms | PIG4; SAA; SAA2; TP53I4 |
Summary | This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Finally, antimicrobial activity against S. aureus and E. coli resides in the N-terminal portion of the mature protein. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11. [provided by RefSeq, Jul 2020] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Bacterial lipoproteins constitute the TLR2-stimulating activity of Serum Amyloid A
,null,
Journal of immunology (Baltimore, Md. : 1950)
,PubMed ID 30158125
[SAA1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403693 | SAA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424788 | SAA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403693 | Transient overexpression lysate of serum amyloid A1 (SAA1), transcript variant 2 |
CNY 3,080.00 |
|
LY424788 | Transient overexpression lysate of serum amyloid A1 (SAA1), transcript variant 1 |
CNY 3,080.00 |
|
PH302738 | SAA1 MS Standard C13 and N15-labeled recombinant protein (NP_954630) |
CNY 19,520.00 |
|
PH310664 | SAA1 MS Standard C13 and N15-labeled recombinant protein (NP_000322) |
CNY 19,520.00 |
|
TP310664 | Recombinant protein of human serum amyloid A1 (SAA1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP750173 | Purified recombinant protein of Human serum amyloid A1 (SAA1), transcript variant 1, 19Arg-End, with N-terminal HIS tag, expressed in E.Coli, 50 ug |
CNY 2,040.00 |
|
TP762437 | Purified recombinant protein of Human serum amyloid A1 (SAA1), transcript variant 2, Arg19-End, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |
其它Serum Amyloid A产品