Cyclophilin E (PPIE) (NM_001195007) Human Recombinant Protein
CAT#: TP331157
Purified recombinant protein of Homo sapiens peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4, 20 µg
View other "Cyclophilin E" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC231157 representing NM_001195007
Red=Cloning site Green=Tags(s) MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNES ELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNP QVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTG GKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEV APDTKASKARGSRKNKDGQERNWGKSQKVESHTI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.4 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001181936 |
Locus ID | 10450 |
UniProt ID | Q9UNP9 |
Cytogenetics | 1p34.2 |
Refseq ORF | 942 |
Synonyms | CYP-33; CYP33 |
Summary | The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities, and it also exhibits RNA-binding activity. Alternative splicing results in multiple transcript variants. A related pseudogene, which is also located on chromosome 1, has been identified. [provided by RefSeq, Aug 2010] |
Protein Families | Transcription Factors |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416859 | PPIE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434156 | PPIE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416859 | Transient overexpression lysate of peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1 |
CNY 3,080.00 |
|
LY434156 | Transient overexpression lysate of peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4 |
CNY 3,080.00 |
|
PH314435 | PPIE MS Standard C13 and N15-labeled recombinant protein (NP_006103) |
CNY 19,520.00 |
|
TP303313 | Purified recombinant protein of Homo sapiens peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP314435 | Recombinant protein of human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720191 | Recombinant protein of human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1 |
CNY 3,140.00 |
其它Cyclophilin E产品