United States
Germany
Japan
United Kingdom
China
Cyclophilin E (PPIE) (NM_006112) Human Recombinant Protein
CAT＃: TP314435
Recombinant protein of human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1, 20 µg
View other "Cyclophilin E" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC214435 protein sequence
Red=Cloning site Green=Tags(s) MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNES ELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNP QVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTG GKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEA QGSKDGKPKQKVIIADCGEYV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 33.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006103 |
| Locus ID | 10450 |
| UniProt ID | Q9UNP9 |
| Refseq Size | 4392 |
| Cytogenetics | 1p34.2 |
| Refseq ORF | 903 |
| Synonyms | CYP-33; CYP33 |
| Summary | The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities, and it also exhibits RNA-binding activity. Alternative splicing results in multiple transcript variants. A related pseudogene, which is also located on chromosome 1, has been identified. [provided by RefSeq, Aug 2010] |
| Protein Families | Transcription Factors |
| Protein Pathways | Spliceosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416859 | PPIE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434156 | PPIE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416859 | Transient overexpression lysate of peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1 |
CNY 3,080.00 |
|
| LY434156 | Transient overexpression lysate of peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4 |
CNY 3,080.00 |
|
| PH314435 | PPIE MS Standard C13 and N15-labeled recombinant protein (NP_006103) |
CNY 19,520.00 |
|
| TP303313 | Purified recombinant protein of Homo sapiens peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP331157 | Purified recombinant protein of Homo sapiens peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP720191 | Recombinant protein of human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1 |
CNY 1,800.00 |
其它Cyclophilin E产品
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
