United States
Germany
Japan
United Kingdom
China
Cyclophilin E (PPIE) (NM_006112) Human Mass Spec Standard
CAT＃: PH314435
PPIE MS Standard C13 and N15-labeled recombinant protein (NP_006103)
View other "Cyclophilin E" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Product images
Specifications
| Product Data | |
| Description | PPIE MS Standard C13 and N15-labeled recombinant protein (NP_006103) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214435 |
| Predicted MW | 33.4 kDa |
| Protein Sequence |
>RC214435 protein sequence
Red=Cloning site Green=Tags(s) MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNES ELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNP QVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTG GKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEA QGSKDGKPKQKVIIADCGEYV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006103 |
| RefSeq Size | 4392 |
| RefSeq ORF | 903 |
| Synonyms | CYP-33; CYP33 |
| Locus ID | 10450 |
| Cytogenetics | 1p34.2 |
| Summary | The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities, and it also exhibits RNA-binding activity. Alternative splicing results in multiple transcript variants. A related pseudogene, which is also located on chromosome 1, has been identified. [provided by RefSeq, Aug 2010] |
| Protein Families | Transcription Factors |
| Protein Pathways | Spliceosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416859 | PPIE HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
| LC434156 | PPIE HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
| LY416859 | Transient overexpression lysate of peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1 |
CN¥ 3,080.00 |
|
| LY434156 | Transient overexpression lysate of peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4 |
CN¥ 3,080.00 |
|
| TP303313 | Purified recombinant protein of Homo sapiens peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 3, 20 µg |
CN¥ 2,900.00 |
|
| TP314435 | Recombinant protein of human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
| TP331157 | Purified recombinant protein of Homo sapiens peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 4, 20 µg |
CN¥ 2,900.00 |
|
| TP720191 | Recombinant protein of human peptidylprolyl isomerase E (cyclophilin E) (PPIE), transcript variant 1 |
CN¥ 1,800.00 |
其它Cyclophilin E产品
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
