alpha Synuclein (SNCA) (NM_001146054) Human Recombinant Protein
CAT#: TP328735
Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 2, 20 µg
View other "alpha Synuclein" proteins (16)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
Cited in 1 publication. |
CN¥ 1,999.00
CN¥ 2,700.00
CN¥ 600.00
CN¥ 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC228735 representing NM_001146054
Red=Cloning site Green=Tags(s) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAV VTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001139526 |
Locus ID | 6622 |
UniProt ID | P37840 |
Cytogenetics | 4q22.1 |
Refseq ORF | 420 |
Synonyms | NACP; PARK1; PARK4; PD1 |
Summary | Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Alzheimer's disease, Parkinson's disease |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
A Translocation Pathway for Vesicle-Mediated Unconventional Protein Secretion.
,null,
Cell
,PubMed ID 32272059
[SNCA]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400127 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC416080 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC431763 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC431764 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY400127 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
CN¥ 3,080.00 |
|
LY416080 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 4 |
CN¥ 3,080.00 |
|
LY431763 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 2 |
CN¥ 3,080.00 |
|
LY431764 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 3 |
CN¥ 3,080.00 |
|
PH310606 | SNCA MS Standard C13 and N15-labeled recombinant protein (NP_000336) |
CN¥ 19,520.00 |
|
PH321446 | SNCA MS Standard C13 and N15-labeled recombinant protein (NP_009292) |
CN¥ 19,520.00 |
|
TP310606 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant NACP140, 20 µg |
CN¥ 2,900.00 |
|
TP321446 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant NACP112, 20 µg |
CN¥ 2,900.00 |
|
TP328736 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 3, 20 µg |
CN¥ 2,900.00 |
|
TP720923 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
CN¥ 3,140.00 |
|
TP721177 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
CN¥ 1,800.00 |
|
TP750040 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1, full length, Tag free, expressed in E. coli, 100ug |
CN¥ 4,020.00 |
其它alpha Synuclein产品