United States
Germany
Japan
United Kingdom
China
alpha Synuclein (SNCA) (NM_000345) Human Recombinant Protein
CAT＃: TP310606
Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant NACP140, 20 µg
View other "alpha Synuclein" proteins (16)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210606 representing NM_000345
Red=Cloning site Green=Tags(s) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAV VTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 14.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000336 |
| Locus ID | 6622 |
| UniProt ID | P37840 |
| Refseq Size | 1543 |
| Cytogenetics | 4q22.1 |
| Refseq ORF | 420 |
| Synonyms | NACP; PARK1; PARK4; PD1 |
| Summary | Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2016] |
| Protein Families | Druggable Genome |
| Protein Pathways | Alzheimer's disease, Parkinson's disease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400127 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416080 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431763 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431764 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400127 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
CNY 3,080.00 |
|
| LY416080 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 4 |
CNY 3,080.00 |
|
| LY431763 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 2 |
CNY 3,080.00 |
|
| LY431764 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 3 |
CNY 3,080.00 |
|
| PH310606 | SNCA MS Standard C13 and N15-labeled recombinant protein (NP_000336) |
CNY 19,520.00 |
|
| PH321446 | SNCA MS Standard C13 and N15-labeled recombinant protein (NP_009292) |
CNY 19,520.00 |
|
| TP321446 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant NACP112, 20 µg |
CNY 2,900.00 |
|
| TP328735 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP328736 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP720923 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
CNY 3,140.00 |
|
| TP721177 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
CNY 3,140.00 |
|
| TP750040 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1, full length, Tag free, expressed in E. coli, 100ug |
CNY 4,020.00 |
其它alpha Synuclein产品
