alpha smooth muscle Actin (ACTA2) (NM_001141945) Human Recombinant Protein
CAT#: TP327802
Recombinant protein of human actin, alpha 2, smooth muscle, aorta (ACTA2), transcript variant 1, 20 µg
View other "alpha smooth muscle Actin" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC227802 protein sequence
Red=Cloning site Green=Tags(s) MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK YPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQA VLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREI VRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETT YNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS LSTFQQMWISKQEYDEAGPSIVHRKCF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Pull-down assay (PMID: 27991922) |
Reference Data | |
RefSeq | NP_001135417 |
Locus ID | 59 |
UniProt ID | P62736 |
Refseq Size | 1798 |
Cytogenetics | 10q23.31 |
Refseq ORF | 1131 |
Synonyms | ACTSA |
Summary | This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a smooth muscle actin that is involved in vascular contractility and blood pressure homeostasis. Mutations in this gene cause a variety of vascular diseases, such as thoracic aortic disease, coronary artery disease, stroke, and Moyamoya disease, as well as multisystemic smooth muscle dysfunction syndrome. [provided by RefSeq, Sep 2017] |
Protein Pathways | Vascular smooth muscle contraction |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Phosphoglycerate mutase 1 promotes cancer cell migration independent of its metabolic activity
,Zhang, D;Jin, N;Sun, W;Li, X;Liu, B;Xie, Z;Qu, J;Xu, J;Yang, X;Su, Y;Tang, S;Han, H;Chen, D;Ding, J;Tan, M;Huang, M;Geng, M;,
Oncogene
,PubMed ID 27991922
[ACTA2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400608 | ACTA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427983 | ACTA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400608 | Transient overexpression lysate of actin, alpha 2, smooth muscle, aorta (ACTA2), transcript variant 2 |
CNY 3,080.00 |
|
LY427983 | Transient overexpression lysate of actin, alpha 2, smooth muscle, aorta (ACTA2), transcript variant 1 |
CNY 3,080.00 |
|
PH327802 | ACTA2 MS Standard C13 and N15-labeled recombinant protein (NP_001135417) |
CNY 19,520.00 |
其它alpha smooth muscle Actin产品