ZFAND1 (NM_024699) Human Recombinant Protein
CAT#: TP324679
Recombinant protein of human zinc finger, AN1-type domain 1 (ZFAND1), 20 µg
View other "ZFAND1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224679 representing NM_024699
Red=Cloning site Green=Tags(s) MAELDIGQHCQVEHCRQRDFLPFVCDDCSGIFCLEHRSRESHGCPEVTVINERLKTDQHTSYPCSFKDCA ERELVAVICPYCEKNFCLRHRHQSDHECEKLEIPKPRMAATQKLVKDIIDSKTGETASKRWKGAKNSETA AKVALMKLKMHADGDKSLPQTERIYFQVFLPKGSKEKSKPMFFCHRWSIGKAIDFAASLARLKNDNNKFT AKKLRLCHITSGEALPLDHTLETWIAKEDCPLYNGGNIILEYLNDEEQFCKNVESYLE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_078975 |
Locus ID | 79752 |
UniProt ID | Q8TCF1 |
Refseq Size | 1793 |
Cytogenetics | 8q21.13 |
Refseq ORF | 804 |
Summary | Plays a role in the regulation of cytoplasmic stress granules (SGs) turnover. SGs are dynamic and transient cytoplasmic ribonucleoprotein assemblies important for cellular protein homeostasis when protein production is suspended after acute exogenous stress (PubMed:29804830). Associates with SGs and is involved in the efficient and specific arsenite-induced clearance process of SGs through the recruitment of the ubiquitin-selective ATPase VCP and the 26S proteasome (PubMed:29804830). This process requires both complexes for efficient degradation of damaged ubiquitinated SG proteins during recovery from arsenite stress, and hence avoiding aberrant cytoplasmic SGs degradation via autophagy (PubMed:29804830).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411156 | ZFAND1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432719 | ZFAND1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411156 | Transient overexpression lysate of zinc finger, AN1-type domain 1 (ZFAND1), transcript variant 1 |
CNY 3,080.00 |
|
LY432719 | Transient overexpression lysate of zinc finger, AN1-type domain 1 (ZFAND1), transcript variant 3 |
CNY 3,080.00 |
|
PH324679 | ZFAND1 MS Standard C13 and N15-labeled recombinant protein (NP_078975) |
CNY 14,250.00 |