ZFAND1 (NM_024699) Human Mass Spec Standard
CAT#: PH324679
ZFAND1 MS Standard C13 and N15-labeled recombinant protein (NP_078975)
View other "ZFAND1" proteins (5)
Need it in bulk or customized? Get a free quote |
CN¥ 14,250.00
Specifications
Product Data | |
Description | ZFAND1 MS Standard C13 and N15-labeled recombinant protein (NP_078975) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224679 |
Predicted MW | 30.6 kDa |
Protein Sequence |
>RC224679 representing NM_024699
Red=Cloning site Green=Tags(s) MAELDIGQHCQVEHCRQRDFLPFVCDDCSGIFCLEHRSRESHGCPEVTVINERLKTDQHTSYPCSFKDCA ERELVAVICPYCEKNFCLRHRHQSDHECEKLEIPKPRMAATQKLVKDIIDSKTGETASKRWKGAKNSETA AKVALMKLKMHADGDKSLPQTERIYFQVFLPKGSKEKSKPMFFCHRWSIGKAIDFAASLARLKNDNNKFT AKKLRLCHITSGEALPLDHTLETWIAKEDCPLYNGGNIILEYLNDEEQFCKNVESYLE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_078975 |
RefSeq Size | 1793 |
RefSeq ORF | 804 |
Locus ID | 79752 |
Cytogenetics | 8q21.13 |
Summary | Plays a role in the regulation of cytoplasmic stress granules (SGs) turnover. SGs are dynamic and transient cytoplasmic ribonucleoprotein assemblies important for cellular protein homeostasis when protein production is suspended after acute exogenous stress (PubMed:29804830). Associates with SGs and is involved in the efficient and specific arsenite-induced clearance process of SGs through the recruitment of the ubiquitin-selective ATPase VCP and the 26S proteasome (PubMed:29804830). This process requires both complexes for efficient degradation of damaged ubiquitinated SG proteins during recovery from arsenite stress, and hence avoiding aberrant cytoplasmic SGs degradation via autophagy (PubMed:29804830).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411156 | ZFAND1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC432719 | ZFAND1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY411156 | Transient overexpression lysate of zinc finger, AN1-type domain 1 (ZFAND1), transcript variant 1 |
CN¥ 3,080.00 |
|
LY432719 | Transient overexpression lysate of zinc finger, AN1-type domain 1 (ZFAND1), transcript variant 3 |
CN¥ 3,080.00 |
|
TP324679 | Recombinant protein of human zinc finger, AN1-type domain 1 (ZFAND1), 20 µg |
CN¥ 2,900.00 |