CELF2 (NM_006561) Human Recombinant Protein
CAT#: TP324548
Recombinant protein of human CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 2, 20 µg
View other "CELF2" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224548 representing NM_006561
Red=Cloning site Green=Tags(s) MTSAFKLDFLPDMMVEGRLLVPDRINGTANKMNGALDHSDQPDPDAIKMFVGQIPRSWSEKELKELFEPY GAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRK LFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSS PIVVKFADTQKDKEQRRLQQQLAQQMQQLNTATWGNLTGLGGLTPQYLALLQQATSSSNLGAFSGIQQMA GMNALQLQNLATLAAAAAAAQTSATSTNANPLSTTSSALGALTSPVAASTPNSTAGAAMNSLTSLGTLQG LAGATVGLNNINALAVAQMLSGMAALNGGLGATGLTNGTAGTMDALTQAYSGIQQYAAAALPTLYSQSLL QQQSAAGSQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSA QAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006552 |
Locus ID | 10659 |
UniProt ID | O95319 |
Refseq Size | 8005 |
Cytogenetics | 10p14 |
Refseq ORF | 1563 |
Synonyms | BRUNOL3; CELF-2; CUG-BP2; CUGBP2; ETR-3; ETR3; NAPOR |
Summary | Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416560 | CELF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC421224 | CELF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC422579 | CELF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LY416560 | Transient overexpression lysate of CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 2 |
CN¥ 4,840.00 |
|
LY421224 | Transient overexpression lysate of CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 4 |
CN¥ 4,840.00 |
|
LY422579 | Transient overexpression lysate of CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 3 |
CN¥ 4,840.00 |
|
PH322724 | CELF2 MS Standard C13 and N15-labeled recombinant protein (NP_001077060) |
CN¥ 14,250.00 |
|
PH324548 | CELF2 MS Standard C13 and N15-labeled recombinant protein (NP_006552) |
CN¥ 19,520.00 |
|
TP322724 | Purified recombinant protein of Homo sapiens CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 4, 20 µg |
CN¥ 2,900.00 |