United States
Germany
Japan
United Kingdom
China
CELF2 (NM_001083591) Human Mass Spec Standard
CAT＃: PH322724
CELF2 MS Standard C13 and N15-labeled recombinant protein (NP_001077060)
View other "CELF2" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
Specifications
| Product Data | |
| Description | CELF2 MS Standard C13 and N15-labeled recombinant protein (NP_001077060) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222724 |
| Predicted MW | 51.9 kDa |
| Protein Sequence |
>RC222724 representing NM_001083591
Red=Cloning site Green=Tags(s) MNGALDHSDQPDPDAIKMFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRK AALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRIL RGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQLNT ATWGNLTGLGGLTPQYLALLQQATSSSNLGAFSGIQQMAGMNALQLQNLATLAAAAAAAQTSATSTNANP LSTTSSALGALTSPVAASTPNSTAGAAMNSLTSLGTLQGLAGATVGLNNINALAGTINSMAALNGGLGAT GLTNGTAGTMDALTQAYSGIQQYAAAALPTLYSQSLLQQQSAAGSQKEGPEGANLFIYHLPQEFGDQDIL QMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001077060 |
| RefSeq Size | 8053 |
| RefSeq ORF | 1464 |
| Synonyms | BRUNOL3; CELF-2; CUG-BP2; CUGBP2; ETR-3; ETR3; NAPOR |
| Locus ID | 10659 |
| Cytogenetics | 10p14 |
| Summary | Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416560 | CELF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC421224 | CELF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC422579 | CELF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY416560 | Transient overexpression lysate of CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 2 |
CNY 4,840.00 |
|
| LY421224 | Transient overexpression lysate of CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 4 |
CNY 4,840.00 |
|
| LY422579 | Transient overexpression lysate of CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 3 |
CNY 4,840.00 |
|
| PH324548 | CELF2 MS Standard C13 and N15-labeled recombinant protein (NP_006552) |
CNY 19,520.00 |
|
| TP322724 | Purified recombinant protein of Homo sapiens CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP324548 | Recombinant protein of human CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 2, 20 µg |
CNY 2,900.00 |
