CELF2 (NM_006561) Human Mass Spec Standard
CAT#: PH324548
CELF2 MS Standard C13 and N15-labeled recombinant protein (NP_006552)
View other "CELF2" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CELF2 MS Standard C13 and N15-labeled recombinant protein (NP_006552) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224548 |
Predicted MW | 55.6 kDa |
Protein Sequence |
>RC224548 representing NM_006561
Red=Cloning site Green=Tags(s) MTSAFKLDFLPDMMVEGRLLVPDRINGTANKMNGALDHSDQPDPDAIKMFVGQIPRSWSEKELKELFEPY GAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRK LFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSS PIVVKFADTQKDKEQRRLQQQLAQQMQQLNTATWGNLTGLGGLTPQYLALLQQATSSSNLGAFSGIQQMA GMNALQLQNLATLAAAAAAAQTSATSTNANPLSTTSSALGALTSPVAASTPNSTAGAAMNSLTSLGTLQG LAGATVGLNNINALAVAQMLSGMAALNGGLGATGLTNGTAGTMDALTQAYSGIQQYAAAALPTLYSQSLL QQQSAAGSQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSA QAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006552 |
RefSeq Size | 8005 |
RefSeq ORF | 1563 |
Synonyms | BRUNOL3; CELF-2; CUG-BP2; CUGBP2; ETR-3; ETR3; NAPOR |
Locus ID | 10659 |
Cytogenetics | 10p14 |
Summary | Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416560 | CELF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC421224 | CELF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC422579 | CELF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY416560 | Transient overexpression lysate of CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 2 |
CNY 4,840.00 |
|
LY421224 | Transient overexpression lysate of CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 4 |
CNY 4,840.00 |
|
LY422579 | Transient overexpression lysate of CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 3 |
CNY 4,840.00 |
|
PH322724 | CELF2 MS Standard C13 and N15-labeled recombinant protein (NP_001077060) |
CNY 14,250.00 |
|
TP322724 | Purified recombinant protein of Homo sapiens CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP324548 | Recombinant protein of human CUG triplet repeat, RNA binding protein 2 (CUGBP2), transcript variant 2, 20 µg |
CNY 2,900.00 |