DCTD (NM_001012732) Human Recombinant Protein
CAT#: TP323090
Recombinant protein of human dCMP deaminase (DCTD), transcript variant 1, 20 µg
View other "DCTD" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223090 representing NM_001012732
Red=Cloning site Green=Tags(s) MVGGGQPCGPNMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNG CSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMS DKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001012750 |
Locus ID | 1635 |
UniProt ID | P32321 |
Refseq Size | 2042 |
Cytogenetics | 4q35.1 |
Refseq ORF | 567 |
Summary | The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | Metabolic pathways, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419656 | DCTD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422825 | DCTD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419656 | Transient overexpression lysate of dCMP deaminase (DCTD), transcript variant 2 |
CNY 3,080.00 |
|
LY422825 | Transient overexpression lysate of dCMP deaminase (DCTD), transcript variant 1 |
CNY 3,080.00 |
|
PH317231 | DCTD MS Standard C13 and N15-labeled recombinant protein (NP_001912) |
CNY 19,520.00 |
|
PH323090 | DCTD MS Standard C13 and N15-labeled recombinant protein (NP_001012750) |
CNY 19,520.00 |
|
TP317231 | Recombinant protein of human dCMP deaminase (DCTD), transcript variant 2, 20 µg |
CNY 2,900.00 |