DCTD (NM_001921) Human Mass Spec Standard
CAT#: PH317231
DCTD MS Standard C13 and N15-labeled recombinant protein (NP_001912)
View other "DCTD" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | DCTD MS Standard C13 and N15-labeled recombinant protein (NP_001912) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217231 |
Predicted MW | 21.01 kDa |
Protein Sequence |
>RC217231 representing NM_001921
Red=Cloning site Green=Tags(s) MVGGGQPCGPNMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNG CSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMS DKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001912 |
RefSeq Size | 2019 |
RefSeq ORF | 567 |
Locus ID | 1635 |
Cytogenetics | 4q35.1 |
Summary | The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | Metabolic pathways, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419656 | DCTD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422825 | DCTD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419656 | Transient overexpression lysate of dCMP deaminase (DCTD), transcript variant 2 |
CNY 3,080.00 |
|
LY422825 | Transient overexpression lysate of dCMP deaminase (DCTD), transcript variant 1 |
CNY 3,080.00 |
|
PH323090 | DCTD MS Standard C13 and N15-labeled recombinant protein (NP_001012750) |
CNY 19,520.00 |
|
TP317231 | Recombinant protein of human dCMP deaminase (DCTD), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP323090 | Recombinant protein of human dCMP deaminase (DCTD), transcript variant 1, 20 µg |
CNY 2,900.00 |