DCTD Rabbit Polyclonal Antibody
CNY 5,200.00
CNY 2,900.00
CNY 6,650.00
CNY 3,080.00
CNY 9,998.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DCTD antibody: synthetic peptide directed towards the middle region of human DCTD. Synthetic peptide located within the following region: MSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 21 kDa |
Gene Name | dCMP deaminase |
Database Link | |
Background | The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene. |
Synonyms | MGC111062 |
Note | Immunogen Sequence Homology: Pig: 100%; Goat: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Dog: 86%; Horse: 86%; Rabbit: 86% |
Reference Data | |
Protein Pathways | Metabolic pathways, Pyrimidine metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |