PBR (TSPO) (NM_000714) Human Recombinant Protein
CAT#: TP320107
Recombinant protein of human translocator protein (18kDa) (TSPO), transcript variant PBR, 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 4 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220107 protein sequence
Red=Cloning site Green=Tags(s) MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKE LGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPY LAWLAFATTLNYCVWRDNHGWHGGRRLPE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Surface Plasmon Ressonance (SPR) (PMID: 27855359) Surface Plasmon Ressonance (SPR) (PMID: 29031071) |
Reference Data | |
RefSeq | NP_000705 |
Locus ID | 706 |
UniProt ID | P30536 |
Refseq Size | 921 |
Cytogenetics | 22q13.2 |
Refseq ORF | 507 |
Synonyms | BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS; pk18; PKBS; PTBR |
Summary | Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternatively spliced transcript variants have been reported; one of the variants lacks an internal exon and is considered non-coding, and the other variants encode the same protein. [provided by RefSeq, Feb 2012] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Neuroactive ligand-receptor interaction |
Citations (4)
The use of this Proteins has been cited in the following citations: |
---|
The translocator protein ligands as mitochondrial functional modulators for the potential anti-Alzheimer agents
,null,
Journal of Enzyme Inhibition and Medicinal Chemistry
,PubMed ID 33752569
[TSPO]
|
Concentration, distribution, and influence of aging on the 18 kDa translocator protein in human brain: Implications for brain imaging studies
,null,
Journal of Cerebral Blood Flow & Metabolism
,PubMed ID 31220997
[TSPO]
|
Discovery of thienopyrrolotriazine derivatives to protect mitochondrial function against Aβ-induced neurotoxicity
,Kim, T;Son, WS;Morshed, MN;Londhe, AM;Jung, SY;Park, JH;Park, WK;Lim, SM;Park, KD;Cho, SJ;Jeong, KS;Lee, J;Pae, AN;,
Eur J Med Chem
,PubMed ID 29031071
[TSPO]
|
Discovery of benzimidazole derivatives as modulators of mitochondrial function: A potential treatment for Alzheimer's disease
,Kim, T;Yang, HY;Park, BG;Jung, SY;Park, JH;Park, KD;Min, SJ;Tae, J;Yang, H;Cho, S;Cho, SJ;Song, H;Mook-Jung, I;Lee, J;Pae, AN;,
Eur J Med Chem
,PubMed ID 27855359
[TSPO]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424543 | TSPO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424543 | Transient overexpression lysate of translocator protein (18kDa) (TSPO), transcript variant PBR |
CNY 3,080.00 |
|
PH320107 | TSPO MS Standard C13 and N15-labeled recombinant protein (NP_000705) |
CNY 19,520.00 |