PBR (TSPO) (NM_000714) Human Mass Spec Standard
CAT#: PH320107
TSPO MS Standard C13 and N15-labeled recombinant protein (NP_000705)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TSPO MS Standard C13 and N15-labeled recombinant protein (NP_000705) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220107 |
Predicted MW | 18.8 kDa |
Protein Sequence |
>RC220107 protein sequence
Red=Cloning site Green=Tags(s) MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKE LGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPY LAWLAFATTLNYCVWRDNHGWHGGRRLPE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000705 |
RefSeq Size | 921 |
RefSeq ORF | 507 |
Synonyms | BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS; pk18; PKBS; PTBR |
Locus ID | 706 |
Cytogenetics | 22q13.2 |
Summary | Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternatively spliced transcript variants have been reported; one of the variants lacks an internal exon and is considered non-coding, and the other variants encode the same protein. [provided by RefSeq, Feb 2012] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Neuroactive ligand-receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424543 | TSPO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424543 | Transient overexpression lysate of translocator protein (18kDa) (TSPO), transcript variant PBR |
CNY 3,080.00 |
|
TP320107 | Recombinant protein of human translocator protein (18kDa) (TSPO), transcript variant PBR, 20 µg |
CNY 2,900.00 |