PBR (TSPO) (NM_000714) Human Tagged ORF Clone
CAT#: RC220107
TSPO (Myc-DDK-tagged)-Human translocator protein (18kDa) (TSPO), transcript variant PBR
ORF Plasmid: tGFP
"NM_000714" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,990.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | BPBS; BZRP; DBI; IBP; MBR; mDRC; PBR; PBS; pk18; PKBS; PTBR |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC220107 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCCCGCCCTGGGTGCCCGCCATGGGCTTCACGCTGGCGCCCAGCCTGGGGTGCTTCGTGGGCTCCC GCTTTGTCCACGGCGAGGGTCTCCGCTGGTACGCCGGCCTGCAGAAGCCCTCGTGGCACCCGCCCCACTG GGTGCTGGGCCCTGTCTGGGGCACGCTCTACTCAGCCATGGGGTACGGCTCCTACCTGGTCTGGAAAGAG CTGGGAGGCTTCACAGAGAAGGCTGTGGTTCCCCTGGGCCTCTACACTGGGCAGCTGGCCCTGAACTGGG CATGGCCCCCCATCTTCTTTGGTGCCCGACAAATGGGCTGGGCCTTGGTGGATCTCCTGCTGGTCAGTGG GGCGGCGGCAGCCACTACCGTGGCCTGGTACCAGGTGAGCCCGCTGGCCGCCCGCCTGCTCTACCCCTAC CTGGCCTGGCTGGCCTTCGCGACCACACTCAACTACTGCGTATGGCGGGACAACCATGGCTGGCATGGGG GACGGCGGCTGCCAGAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC220107 protein sequence
Red=Cloning site Green=Tags(s) MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKE LGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPY LAWLAFATTLNYCVWRDNHGWHGGRRLPE myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_000714 |
ORF Size | 507 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_000714.3 |
RefSeq Size | 921 bp |
RefSeq ORF | 510 bp |
Locus ID | 706 |
UniProt ID | P30536 |
Domains | TspO_MBR |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Neuroactive ligand-receptor interaction |
MW | 18.8 kDa |
Gene Summary | Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternatively spliced transcript variants have been reported; one of the variants lacks an internal exon and is considered non-coding, and the other variants encode the same protein. [provided by RefSeq, Feb 2012] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
The Cholesterol-Binding Translocator Protein (18 kDa) Regulates Hepatic Steatosis and Bile Acid Synthesis in Non-Alcoholic Fatty Liver Disease
,Li, Y;Chen, L;Li, L;Sottas, C;Petrillo, S;Lazaris, A;Metrakos, P;Wu, H;Wolff, J;Silvescu, C;Garza, S;Cheung, G;Huang, T;Fan, J;Culty, M;Stiles, B;Asahina, K;Papadopoulos, V;,
SSRN Electronic Journal
[PBR]
|
Translocator Protein Blockade Reduces Prostate Tumor Growth
,Arlee Fafalios, Ardavan Akhavan, Anil V. Parwani, Robert R. Bies, Kevin J. McHugh, and Beth R. Pflug,
Clin. Cancer Res., Oct 2009; 15: 6177 - 6184
[PBR]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC220107L1 | Lenti ORF clone of Human translocator protein (18kDa) (TSPO), transcript variant PBR, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC220107L2 | Lenti ORF clone of Human translocator protein (18kDa) (TSPO), transcript variant PBR, mGFP tagged |
CNY 4,800.00 |
|
RC220107L3 | Lenti ORF clone of Human translocator protein (18kDa) (TSPO), transcript variant PBR, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC220107L4 | Lenti ORF clone of Human translocator protein (18kDa) (TSPO), transcript variant PBR, mGFP tagged |
CNY 5,890.00 |
|
RG220107 | TSPO (tGFP-tagged) - Human translocator protein (18kDa) (TSPO), transcript variant PBR |
CNY 4,000.00 |
|
SC111597 | TSPO (untagged)-Human translocator protein (18kDa) (TSPO), transcript variant PBR |
CNY 2,400.00 |