CD32B (FCGR2B) (NM_001002273) Human Recombinant Protein
CAT#: TP319569
Recombinant protein of human Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 2, 20 µg
View other "CD32B" proteins (14)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219569 representing NM_001002273
Red=Cloning site Green=Tags(s) MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAPPKAVLKLEPQWINVLQEDSVTLTC RGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLE FQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVT ITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISANPTNPDEADKVGAENTITYSLLMHPDA LEEPDDQNRI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001002273 |
Locus ID | 2213 |
UniProt ID | P31994 |
Refseq Size | 1573 |
Cytogenetics | 1q23.3 |
Refseq ORF | 870 |
Synonyms | CD32; CD32B; FCG2; FCGR2; FCGR2C; FcRII-c; IGFR2 |
Summary | The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
Protein Families | ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | B cell receptor signaling pathway, Fc gamma R-mediated phagocytosis, Systemic lupus erythematosus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400365 | FCGR2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC401309 | FCGR2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424200 | FCGR2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424201 | FCGR2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434147 | FCGR2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400365 | Transient overexpression lysate of Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 4 |
CNY 3,080.00 |
|
LY401309 | Transient overexpression lysate of Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 1 |
CNY 3,080.00 |
|
LY424200 | Transient overexpression lysate of Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 2 |
CNY 3,080.00 |
|
LY424201 | Transient overexpression lysate of Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 3 |
CNY 3,080.00 |
|
LY434147 | Transient overexpression lysate of Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 5 |
CNY 3,080.00 |
|
PH304496 | FCGR2B MS Standard C13 and N15-labeled recombinant protein (NP_001002275) |
CNY 19,520.00 |
|
PH319569 | FCGR2B MS Standard C13 and N15-labeled recombinant protein (NP_001002273) |
CNY 19,520.00 |
|
TP304496 | Recombinant protein of human Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP720664 | Purified recombinant protein of Human Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 4 |
CNY 3,140.00 |