United States
Germany
Japan
United Kingdom
China
CD32B (FCGR2B) (NM_001002273) Human Mass Spec Standard
CAT＃: PH319569
FCGR2B MS Standard C13 and N15-labeled recombinant protein (NP_001002273)
View other "CD32B" proteins (14)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | FCGR2B MS Standard C13 and N15-labeled recombinant protein (NP_001002273) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219569 |
| Predicted MW | 31.7 kDa |
| Protein Sequence |
>RC219569 representing NM_001002273
Red=Cloning site Green=Tags(s) MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAPPKAVLKLEPQWINVLQEDSVTLTC RGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLE FQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVT ITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISANPTNPDEADKVGAENTITYSLLMHPDA LEEPDDQNRI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001002273 |
| RefSeq Size | 1573 |
| RefSeq ORF | 870 |
| Synonyms | CD32; CD32B; FCG2; FCGR2; FCGR2C; FcRII-c; IGFR2 |
| Locus ID | 2213 |
| Cytogenetics | 1q23.3 |
| Summary | The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
| Protein Families | ES Cell Differentiation/IPS, Transmembrane |
| Protein Pathways | B cell receptor signaling pathway, Fc gamma R-mediated phagocytosis, Systemic lupus erythematosus |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400365 | FCGR2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC401309 | FCGR2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424200 | FCGR2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424201 | FCGR2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434147 | FCGR2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400365 | Transient overexpression lysate of Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 4 |
CNY 3,080.00 |
|
| LY401309 | Transient overexpression lysate of Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 1 |
CNY 3,080.00 |
|
| LY424200 | Transient overexpression lysate of Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 2 |
CNY 3,080.00 |
|
| LY424201 | Transient overexpression lysate of Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 3 |
CNY 3,080.00 |
|
| LY434147 | Transient overexpression lysate of Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 5 |
CNY 3,080.00 |
|
| PH304496 | FCGR2B MS Standard C13 and N15-labeled recombinant protein (NP_001002275) |
CNY 19,520.00 |
|
| TP304496 | Recombinant protein of human Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP319569 | Recombinant protein of human Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP720664 | Purified recombinant protein of Human Fc fragment of IgG, low affinity IIb, receptor (CD32) (FCGR2B), transcript variant 4 |
CNY 3,140.00 |
