BDNF (NM_170734) Human Recombinant Protein
CAT#: TP317124
Recombinant protein of human brain-derived neurotrophic factor (BDNF), transcript variant 6, 20 µg
View other "BDNF" proteins (36)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217124 representing NM_170734
Red=Cloning site Green=Tags(s) MQSREEEWFHQVRRVMTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRG LTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMR VRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG CRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_733930 |
Locus ID | 627 |
UniProt ID | P23560 |
Refseq Size | 3958 |
Cytogenetics | 11p14.1 |
Refseq ORF | 786 |
Synonyms | ANON2; BULN2 |
Summary | This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer's, Parkinson's, and Huntington's disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders. [provided by RefSeq, Nov 2015] |
Protein Families | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Secreted Protein, Transmembrane |
Protein Pathways | Huntington's disease, MAPK signaling pathway, Neurotrophin signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400640 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC403526 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC403537 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406735 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406736 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406855 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428351 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428352 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428353 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428354 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428355 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428357 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428358 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428359 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428360 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428362 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400640 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 4 |
CNY 3,080.00 |
|
LY403526 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 6 |
CNY 3,080.00 |
|
LY403537 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 3 |
CNY 3,080.00 |
|
LY406735 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 2 |
CNY 3,080.00 |
|
LY406736 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 5 |
CNY 3,080.00 |
|
LY406855 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 1 |
CNY 3,080.00 |
|
LY428351 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 7 |
CNY 3,080.00 |
|
LY428352 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 8 |
CNY 3,080.00 |
|
LY428353 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 9 |
CNY 3,080.00 |
|
LY428354 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 10 |
CNY 3,080.00 |
|
LY428355 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 17 |
CNY 3,080.00 |
|
LY428357 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 11 |
CNY 3,080.00 |
|
LY428358 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 12 |
CNY 3,080.00 |
|
LY428359 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 13 |
CNY 3,080.00 |
|
LY428360 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 14 |
CNY 3,080.00 |
|
LY428362 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 16 |
CNY 3,080.00 |
|
PH317124 | BDNF MS Standard C13 and N15-labeled recombinant protein (NP_733930) |
CNY 19,520.00 |
|
TP720589 | Purified recombinant protein of Human brain-derived neurotrophic factor (BDNF), transcript variant 2 |
CNY 1,800.00 |
|
TP720590 | Purified recombinant protein of Human brain-derived neurotrophic factor (BDNF), transcript variant 2 |
CNY 3,140.00 |
|
TP762592 | Purified recombinant protein of Human brain-derived neurotrophic factor (BDNF), transcript variant 4, full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug |
CNY 2,480.00 |