BDNF (NM_170734) Human Mass Spec Standard
CAT#: PH317124
BDNF MS Standard C13 and N15-labeled recombinant protein (NP_733930)
View other "BDNF" proteins (36)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | BDNF MS Standard C13 and N15-labeled recombinant protein (NP_733930) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217124 |
Predicted MW | 25.7 kDa |
Protein Sequence |
>RC217124 representing NM_170734
Red=Cloning site Green=Tags(s) MQSREEEWFHQVRRVMTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRG LTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMR VRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG CRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_733930 |
RefSeq Size | 3958 |
RefSeq ORF | 786 |
Synonyms | ANON2; BULN2 |
Locus ID | 627 |
Cytogenetics | 11p14.1 |
Summary | This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer's, Parkinson's, and Huntington's disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders. [provided by RefSeq, Nov 2015] |
Protein Families | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Secreted Protein, Transmembrane |
Protein Pathways | Huntington's disease, MAPK signaling pathway, Neurotrophin signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400640 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC403526 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC403537 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC406735 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC406736 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC406855 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428351 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428352 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428353 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428354 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428355 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428357 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428358 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428359 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428360 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428362 | BDNF HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY400640 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 4 |
CN¥ 3,080.00 |
|
LY403526 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 6 |
CN¥ 3,080.00 |
|
LY403537 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 3 |
CN¥ 3,080.00 |
|
LY406735 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 2 |
CN¥ 3,080.00 |
|
LY406736 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 5 |
CN¥ 3,080.00 |
|
LY406855 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 1 |
CN¥ 3,080.00 |
|
LY428351 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 7 |
CN¥ 3,080.00 |
|
LY428352 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 8 |
CN¥ 3,080.00 |
|
LY428353 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 9 |
CN¥ 3,080.00 |
|
LY428354 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 10 |
CN¥ 3,080.00 |
|
LY428355 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 17 |
CN¥ 3,080.00 |
|
LY428357 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 11 |
CN¥ 3,080.00 |
|
LY428358 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 12 |
CN¥ 3,080.00 |
|
LY428359 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 13 |
CN¥ 3,080.00 |
|
LY428360 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 14 |
CN¥ 3,080.00 |
|
LY428362 | Transient overexpression lysate of brain-derived neurotrophic factor (BDNF), transcript variant 16 |
CN¥ 3,080.00 |
|
TP317124 | Recombinant protein of human brain-derived neurotrophic factor (BDNF), transcript variant 6, 20 µg |
CN¥ 2,900.00 |
|
TP720589 | Purified recombinant protein of Human brain-derived neurotrophic factor (BDNF), transcript variant 2 |
CN¥ 1,800.00 |
|
TP720590 | Purified recombinant protein of Human brain-derived neurotrophic factor (BDNF), transcript variant 2 |
CN¥ 3,140.00 |
|
TP762592 | Purified recombinant protein of Human brain-derived neurotrophic factor (BDNF), transcript variant 4, full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug |
CN¥ 2,480.00 |