Peroxiredoxin 2 (PRDX2) (NM_181738) Human Recombinant Protein
CAT#: TP309548
Recombinant protein of human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg
View other "Peroxiredoxin 2" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209548 representing NM_181738
Red=Cloning site Green=Tags(s) MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGC EVLGVSVDSQFTHLAWYEQGPKREVAAKLTPSGPSSVASWPLLNLWNLRFPIVKIMETLPPKSLRMMTVI SI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_859428 |
Locus ID | 7001 |
UniProt ID | P32119 |
Refseq Size | 710 |
Cytogenetics | 19p13.13 |
Refseq ORF | 426 |
Synonyms | NKEFB; PRP; PRX2; PRXII; PTX1; TDPX1; TPX1; TSA |
Summary | This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein plays an antioxidant protective role in cells, and it may contribute to the antiviral activity of CD8(+) T-cells. The crystal structure of this protein has been resolved to 2.7 angstroms. This protein prevents hemolytic anemia from oxidative stress by stabilizing hemoglobin, thus making this gene a therapeutic target for patients with hemolytic anemia. This protein may have a proliferative effect and play a role in cancer development or progression. Related pseudogenes have been identified on chromosomes 5, 6, 10 and 13. [provided by RefSeq, Mar 2013] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405644 | PRDX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417052 | PRDX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429270 | PRDX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405644 | Transient overexpression lysate of peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3,080.00 |
|
LY417052 | Transient overexpression lysate of peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
LY429270 | Transient overexpression lysate of peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
PH307413 | PRDX2 MS Standard C13 and N15-labeled recombinant protein (NP_005800) |
CNY 14,250.00 |
|
PH309548 | PRDX2 MS Standard C13 and N15-labeled recombinant protein (NP_859428) |
CNY 19,520.00 |
|
TP307413 | Recombinant protein of human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Peroxiredoxin 2产品