United States
Germany
Japan
United Kingdom
China
Peroxiredoxin 2 (PRDX2) (NM_005809) Human Mass Spec Standard
CAT＃: PH307413
PRDX2 MS Standard C13 and N15-labeled recombinant protein (NP_005800)
View other "Peroxiredoxin 2" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
Specifications
| Product Data | |
| Description | PRDX2 MS Standard C13 and N15-labeled recombinant protein (NP_005800) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207413 |
| Predicted MW | 21.7 kDa |
| Protein Sequence |
>RC207413 representing NM_005809
Red=Cloning site Green=Tags(s) MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGC EVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQ ITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005800 |
| RefSeq Size | 1039 |
| RefSeq ORF | 594 |
| Synonyms | HEL-S-2a; NKEF-B; NKEFB; PRP; PRX2; PRXII; PTX1; TDPX1; TPX1; TSA |
| Locus ID | 7001 |
| Cytogenetics | 19p13.13 |
| Summary | This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein plays an antioxidant protective role in cells, and it may contribute to the antiviral activity of CD8(+) T-cells. The crystal structure of this protein has been resolved to 2.7 angstroms. This protein prevents hemolytic anemia from oxidative stress by stabilizing hemoglobin, thus making this gene a therapeutic target for patients with hemolytic anemia. This protein may have a proliferative effect and play a role in cancer development or progression. Related pseudogenes have been identified on chromosomes 5, 6, 10 and 13. [provided by RefSeq, Mar 2013] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405644 | PRDX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417052 | PRDX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429270 | PRDX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405644 | Transient overexpression lysate of peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3,080.00 |
|
| LY417052 | Transient overexpression lysate of peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
| LY429270 | Transient overexpression lysate of peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
| PH309548 | PRDX2 MS Standard C13 and N15-labeled recombinant protein (NP_859428) |
CNY 19,520.00 |
|
| TP307413 | Recombinant protein of human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP309548 | Recombinant protein of human peroxiredoxin 2 (PRDX2), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg |
CNY 2,900.00 |
其它Peroxiredoxin 2产品
