GAA (NM_001079804) Human Recombinant Protein
CAT#: TP308033
Recombinant protein of human glucosidase, alpha; acid (GAA), transcript variant 3, 20 µg
View other "GAA" proteins (12)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208033 protein sequence
Red=Cloning site Green=Tags(s) MGVRHPPCSHRLLAVCALVSLATAALLGHILLHDFLLVPRELSGSSPVLEETHPAHQQGASRPGPRDAQA HPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGAQMGQPWCFFPPSYPSYKLEN LSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYS VEFSEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWN RDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSV VQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDG FRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKVWPGSTAFPDF TNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELENPPYVPGVVGGTLQAATICAS SHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPE ILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALT LRYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLG TWYDLQTVPVEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQP MALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQLQKVTVLGVA TAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 102.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001073272 |
Locus ID | 2548 |
UniProt ID | P10253 |
Refseq Size | 3517 |
Cytogenetics | 17q25.3 |
Refseq ORF | 2856 |
Synonyms | LYAG |
Summary | This gene encodes lysosomal alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. The encoded preproprotein is proteolytically processed to generate multiple intermediate forms and the mature form of the enzyme. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Galactose metabolism, Lysosome, Metabolic pathways, Starch and sucrose metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400052 | GAA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421540 | GAA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC421541 | GAA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400052 | Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 1 |
CNY 3,080.00 |
|
LY421540 | Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 2 |
CNY 4,840.00 |
|
LY421541 | Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 3 |
CNY 3,080.00 |
|
PH308033 | GAA MS Standard C13 and N15-labeled recombinant protein (NP_001073272) |
CNY 19,520.00 |
|
PH315796 | GAA MS Standard C13 and N15-labeled recombinant protein (NP_000143) |
CNY 19,520.00 |
|
PH315840 | GAA MS Standard C13 and N15-labeled recombinant protein (NP_001073271) |
CNY 19,520.00 |
|
TP315796 | Recombinant protein of human glucosidase, alpha; acid (GAA), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP315840 | Recombinant protein of human glucosidase, alpha; acid (GAA), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP701073 | Purified recombinant protein of Human glucosidase, alpha, acid (GAA), with N-terminal His tag, secretory expressed in HEK293 cells, 20ug |
CNY 7,106.00 |