FAM172A (NM_032042) Human Recombinant Protein
CAT#: TP304600
Recombinant protein of human family with sequence similarity 172, member A (FAM172A), 20 µg
View other "FAM172A" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204600 protein sequence
Red=Cloning site Green=Tags(s) MSISLSSLILLPIWINMAQIQQGGPDEKEKTTALKDLLSRIDLDELMKKDEPPLDFPDTLEGFEYAFNEK GQLRHIKTGEPFVFNYREDLHRWNQKRYEALGEIITKYVYELLEKDCNLKKVSIPVDATESEPKSFIFMS EDALTNPQKLMVLIHGSGVVRAGQWARRLIINEDLDSGTQIPFIKRAVAEGYGVIVLNPNENYIEVEKPK IHVQSSSDSSDEPAEKRERKDKVSKETKKRRDFYEKYRNPQREKEMMQLYIRENGSPEEHAIYVWDHFIA QAAAENVFFVAHSYGGLAFVELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSS EPLDTSVESMLPDCPRVSAGTDRHELTSWKSFPSIFKFFTEASEAKTSSLKPAVTRRSHRIKHEEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_114431 |
Locus ID | 83989 |
UniProt ID | Q8WUF8 |
Refseq Size | 4720 |
Cytogenetics | 5q15 |
Refseq ORF | 1248 |
Synonyms | C5orf21; Toupee |
Summary | Plays a role in the regulation of alternative splicing, by interacting with AGO2 and CHD7. Seems to be required for stabilizing protein-protein interactions at the chromatin-spliceosome interface. May have hydrolase activity.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410351 | FAM172A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431267 | FAM172A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410351 | Transient overexpression lysate of family with sequence similarity 172, member A (FAM172A), transcript variant 1 |
CNY 3,080.00 |
|
LY431267 | Transient overexpression lysate of family with sequence similarity 172, member A (FAM172A), transcript variant 3 |
CNY 3,080.00 |
|
PH304600 | FAM172A MS Standard C13 and N15-labeled recombinant protein (NP_114431) |
CNY 19,520.00 |
其它FAM172A产品