FAM172A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FAM172A Antibody is: synthetic peptide directed towards the middle region of Human FAM172A. Synthetic peptide located within the following region: SSDSSDEPAEKRERKDKVSKETKKRRDFYEKYRNPQREKEMMQLYIRENG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	family with sequence similarity 172 member A
Database Link	NP_001156889 Entrez Gene 83989 Human UniProt ID Q8WUF8
Background	The function of this protein remains unknown.
Synonyms	C5orf21
Note	Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Mouse: 93%; Yeast: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.