HMGN3 (NM_138730) Human Recombinant Protein
CAT#: TP302339
Recombinant protein of human high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 2, 20 µg
View other "HMGN3" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202339 protein sequence
Red=Cloning site Green=Tags(s) MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEA GKEGTEN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_620058 |
Locus ID | 9324 |
UniProt ID | Q15651 |
Refseq Size | 894 |
Cytogenetics | 6q14.1 |
Refseq ORF | 231 |
Synonyms | PNAS-24; PNAS-25; TRIP7 |
Summary | The protein encoded by this gene binds thyroid hormone receptor beta in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is a related pseudogene on chromosome 1. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408537 | HMGN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418127 | HMGN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408537 | Transient overexpression lysate of high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 2 |
CNY 3,080.00 |
|
LY418127 | Transient overexpression lysate of high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 1 |
CNY 3,080.00 |
|
PH302339 | HMGN3 MS Standard C13 and N15-labeled recombinant protein (NP_620058) |
CNY 19,520.00 |
|
PH313403 | HMGN3 MS Standard C13 and N15-labeled recombinant protein (NP_004233) |
CNY 19,520.00 |
|
TP313403 | Recombinant protein of human high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 1, 20 µg |
CNY 2,900.00 |