HMGN3 (NM_138730) Human Mass Spec Standard
CAT#: PH302339
HMGN3 MS Standard C13 and N15-labeled recombinant protein (NP_620058)
View other "HMGN3" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | HMGN3 MS Standard C13 and N15-labeled recombinant protein (NP_620058) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202339 |
Predicted MW | 8.4 kDa |
Protein Sequence |
>RC202339 protein sequence
Red=Cloning site Green=Tags(s) MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEA GKEGTEN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_620058 |
RefSeq Size | 894 |
RefSeq ORF | 231 |
Synonyms | PNAS-24; PNAS-25; TRIP7 |
Locus ID | 9324 |
Cytogenetics | 6q14.1 |
Summary | The protein encoded by this gene binds thyroid hormone receptor beta in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is a related pseudogene on chromosome 1. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408537 | HMGN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418127 | HMGN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408537 | Transient overexpression lysate of high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 2 |
CNY 3,080.00 |
|
LY418127 | Transient overexpression lysate of high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 1 |
CNY 3,080.00 |
|
PH313403 | HMGN3 MS Standard C13 and N15-labeled recombinant protein (NP_004233) |
CNY 19,520.00 |
|
TP302339 | Recombinant protein of human high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP313403 | Recombinant protein of human high mobility group nucleosomal binding domain 3 (HMGN3), transcript variant 1, 20 µg |
CNY 2,900.00 |