Aquaporin 3 (AQP3) (NM_004925) Human Recombinant Protein
CAT#: TP301856
Recombinant protein of human aquaporin 3 (Gill blood group) (AQP3), 20 µg
View other "Aquaporin 3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201856 protein sequence
Red=Cloning site Green=Tags(s) MGRQKELVSRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLG ILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVFGLYYDAIWHFADNQLFVSGP NGTAGIFATYPSGHLDMINGFFDQFIGTASLIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNS GYAVNPARDFGPRLFTALAGWGSAVFTTGQHWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSNEEEN VKLAHVKHKEQI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | In vivo treatment (PMID: 25490291) |
Reference Data | |
RefSeq | NP_004916 |
Locus ID | 360 |
UniProt ID | Q92482 |
Refseq Size | 1882 |
Cytogenetics | 9p13.3 |
Refseq ORF | 876 |
Synonyms | AQP-3; GIL |
Summary | This gene encodes the water channel protein aquaporin 3. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein, also known as aquaporin 0. Aquaporin 3 is localized at the basal lateral membranes of collecting duct cells in the kidney. In addition to its water channel function, aquaporin 3 has been found to facilitate the transport of nonionic small solutes such as urea and glycerol, but to a smaller degree. It has been suggested that water channels can be functionally heterogeneous and possess water and solute permeation mechanisms. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome, Transmembrane |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Effects of Recombinant Aquaporin 3 and Seawater Acclimation on the Expression of Aquaporin 3 and 8 mRNAs in the Parr and Smolt Stages of Rainbow Trout, Oncorhynchus mykiss
,Kim, NN;Choi, YJ;Lim, SG;Kim, B;Choi, CY;,
Ocean and Polar Research
[AQP3]
|
Profiles of hypothalamus-pituitary-interrenal axis gene expression in the parr and smolt stages of rainbow trout, Oncorhynchus mykiss: Effects of recombinant aquaporin 3 and seawater acclimation
,Choi, YJ;Kim, NN;Choi, CY;,
Comp. Biochem. Physiol., Part A Mol. Integr. Physiol.
,PubMed ID 25490291
[AQP3]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401543 | AQP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401543 | Transient overexpression lysate of aquaporin 3 (Gill blood group) (AQP3) |
CNY 3,080.00 |
|
PH301856 | AQP3 MS Standard C13 and N15-labeled recombinant protein (NP_004916) |
CNY 19,520.00 |
其它Aquaporin 3产品