Aquaporin 3 (AQP3) (NM_004925) Human Mass Spec Standard
CAT#: PH301856
AQP3 MS Standard C13 and N15-labeled recombinant protein (NP_004916)
View other "Aquaporin 3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | AQP3 MS Standard C13 and N15-labeled recombinant protein (NP_004916) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201856 |
Predicted MW | 31.5 kDa |
Protein Sequence |
>RC201856 protein sequence
Red=Cloning site Green=Tags(s) MGRQKELVSRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLG ILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVFGLYYDAIWHFADNQLFVSGP NGTAGIFATYPSGHLDMINGFFDQFIGTASLIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNS GYAVNPARDFGPRLFTALAGWGSAVFTTGQHWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSNEEEN VKLAHVKHKEQI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004916 |
RefSeq Size | 1882 |
RefSeq ORF | 876 |
Synonyms | AQP-3; GIL |
Locus ID | 360 |
Cytogenetics | 9p13.3 |
Summary | This gene encodes the water channel protein aquaporin 3. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein, also known as aquaporin 0. Aquaporin 3 is localized at the basal lateral membranes of collecting duct cells in the kidney. In addition to its water channel function, aquaporin 3 has been found to facilitate the transport of nonionic small solutes such as urea and glycerol, but to a smaller degree. It has been suggested that water channels can be functionally heterogeneous and possess water and solute permeation mechanisms. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401543 | AQP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401543 | Transient overexpression lysate of aquaporin 3 (Gill blood group) (AQP3) |
CNY 3,080.00 |
|
TP301856 | Recombinant protein of human aquaporin 3 (Gill blood group) (AQP3), 20 µg |
CNY 2,900.00 |
其它Aquaporin 3产品