EBP50 (SLC9A3R1) (NM_004252) Human Recombinant Protein
CAT#: TP301653
Purified recombinant protein of Homo sapiens solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 1 (SLC9A3R1), 20 µg
View other "EBP50" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
热销蛋白,享双倍赠礼
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201653 protein sequence
Red=Cloning site Green=Tags(s) MSADAAAGAPLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKE THQQVVSRIRAALNAVRLLVVDPETDEQLQKLGVQVREELLRAQEAPGQAEPPAAAEVQGAGNENEPREA DKSHPEQRELRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGK QHGDVVSAIRAGGDETKLLVVDRETDEFFKKCRVIPSQEHLNGPLPVPFTNGEIQKENSREALAEAALES PRPALVRSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPILDFNISLAMAKERAHQKRSSKRAPQMDWSK KNELFSNL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Cell treatment (PMID: 26142394) |
Reference Data | |
RefSeq | NP_004243 |
Locus ID | 9368 |
UniProt ID | O14745 |
Refseq Size | 2032 |
Cytogenetics | 17q25.1 |
Refseq ORF | 1074 |
Synonyms | EBP50; NHERF; NHERF-1; NHERF1; NPHLOP2 |
Summary | This gene encodes a sodium/hydrogen exchanger regulatory cofactor. The protein interacts with and regulates various proteins including the cystic fibrosis transmembrane conductance regulator and G-protein coupled receptors such as the beta2-adrenergic receptor and the parathyroid hormone 1 receptor. The protein also interacts with proteins that function as linkers between integral membrane and cytoskeletal proteins. The protein localizes to actin-rich structures including membrane ruffles, microvilli, and filopodia. Mutations in this gene result in hypophosphatemic nephrolithiasis/osteoporosis type 2, and loss of heterozygosity of this gene is implicated in breast cancer.[provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Expression of Na+/H+ exchanger regulatory factor 1 in autosomal-dominant polycystic kidney disease
,Wang, JQ;Qin, F;Zhu, L;,
J. Int. Med. Res.
,PubMed ID 26142394
[SLC9A3R1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401364 | SLC9A3R1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401364 | Transient overexpression lysate of solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 1 (SLC9A3R1) |
CNY 3,080.00 |
|
PH301653 | SLC9A3R1 MS Standard C13 and N15-labeled recombinant protein (NP_004243) |
CNY 14,250.00 |