EBP50 (SLC9A3R1) (NM_004252) Human Mass Spec Standard
CAT#: PH301653
SLC9A3R1 MS Standard C13 and N15-labeled recombinant protein (NP_004243)
View other "EBP50" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 14,250.00
Specifications
Product Data | |
Description | SLC9A3R1 MS Standard C13 and N15-labeled recombinant protein (NP_004243) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201653 |
Predicted MW | 38.9 kDa |
Protein Sequence |
>RC201653 protein sequence
Red=Cloning site Green=Tags(s) MSADAAAGAPLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKE THQQVVSRIRAALNAVRLLVVDPETDEQLQKLGVQVREELLRAQEAPGQAEPPAAAEVQGAGNENEPREA DKSHPEQRELRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGK QHGDVVSAIRAGGDETKLLVVDRETDEFFKKCRVIPSQEHLNGPLPVPFTNGEIQKENSREALAEAALES PRPALVRSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPILDFNISLAMAKERAHQKRSSKRAPQMDWSK KNELFSNL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004243 |
RefSeq Size | 2032 |
RefSeq ORF | 1074 |
Synonyms | EBP50; NHERF; NHERF-1; NHERF1; NPHLOP2 |
Locus ID | 9368 |
Cytogenetics | 17q25.1 |
Summary | This gene encodes a sodium/hydrogen exchanger regulatory cofactor. The protein interacts with and regulates various proteins including the cystic fibrosis transmembrane conductance regulator and G-protein coupled receptors such as the beta2-adrenergic receptor and the parathyroid hormone 1 receptor. The protein also interacts with proteins that function as linkers between integral membrane and cytoskeletal proteins. The protein localizes to actin-rich structures including membrane ruffles, microvilli, and filopodia. Mutations in this gene result in hypophosphatemic nephrolithiasis/osteoporosis type 2, and loss of heterozygosity of this gene is implicated in breast cancer.[provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401364 | SLC9A3R1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401364 | Transient overexpression lysate of solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 1 (SLC9A3R1) |
CN¥ 3,080.00 |
|
TP301653 | Purified recombinant protein of Homo sapiens solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 1 (SLC9A3R1), 20 µg |
CN¥ 2,900.00 |