EBP50 (SLC9A3R1) Rabbit Polyclonal Antibody
CAT#: TA333974
Rabbit Polyclonal Anti-SLC9A3R1 Antibody
Need it in bulk or conjugated?
Get a free quote
CN¥ 4,628.00
CN¥ 3,080.00
CN¥ 2,900.00
CN¥ 6,650.00
CN¥ 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SLC9A3R1 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLC9A3R1. Synthetic peptide located within the following region: RSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPILDFNISLAMAKERAHQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 39 kDa |
Gene Name | SLC9A3 regulator 1 |
Database Link | |
Background | This gene encodes a sodium/hydrogen exchanger regulatory cofactor. The protein interacts with and regulates various proteins including the cystic fibrosis transmembrane conductance regulator and G-protein coupled receptors such as the beta2-adrenergic receptor and the parathyroid hormone 1 receptor. The protein also interacts with proteins that function as linkers between integral membrane and cytoskeletal proteins. The protein localizes to actin-rich structures including membrane ruffles, microvilli, and filopodia. Mutations in this gene result in hypophosphatemic nephrolithiasis/osteoporosis type 2, and loss of heterozygosity of this gene is implicated in breast cancer. |
Synonyms | EBP50; NHERF; NHERF-1; NHERF1; NPHLOP2 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rat: 93%; Rabbit: 93%; Guinea pig: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |