TRIM32 (NM_012210) Human Recombinant Protein
CAT#: TP301289
Recombinant protein of human tripartite motif-containing 32 (TRIM32), transcript variant 1, 20 µg
View other "TRIM32" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201289 protein sequence
Red=Cloning site Green=Tags(s) MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITRI TSLTQLTDNLTVLKIIDTAGLSEAVGLLMCRSCGRRLPRQFCRSCGLVLCEPCREADHQPPGHCTLPVKE AAEERRRDFGEKLTRLRELMGELQRRKAALEGVSKDLQARYKAVLQEYGHEERRVQDELARSRKFFTGSL AEVEKSNSQVVEEQSYLLNIAEVQAVSRCDYFLAKIKQADVALLEETADEEEPELTASLPRELTLQDVEL LKVGHVGPLQIGQAVKKPRTVNVEDSWAMEATASAASTSVTFREMDMSPEEVVASPRASPAKQRGPEAAS NIQQCLFLKKMGAKGSTPGMFNLPVSLYVTSQGEVLVADRGNYRIQVFTRKGFLKEIRRSPSGIDSFVLS FLGADLPNLTPLSVAMNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPSGQFVVTDVEG GKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCDAEGTVYFTQGLGLNLENRQNEHHLEGGFSIGSVGPDGQ LGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGYSVLIREGLTCPVGIALTPKGQL LVLDCWDHCIKIYSYHLRRYSTP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 71.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036342 |
Locus ID | 22954 |
UniProt ID | Q13049 |
Refseq Size | 3734 |
Cytogenetics | 9q33.1 |
Refseq ORF | 1959 |
Synonyms | BBS11; HT2A; LGMD2H; LGMDR8; TATIP |
Summary | The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402167 | TRIM32 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420491 | TRIM32 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC426077 | TRIM32 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402167 | Transient overexpression lysate of tripartite motif-containing 32 (TRIM32), transcript variant 1 |
CNY 3,080.00 |
|
LY420491 | Transient overexpression lysate of tripartite motif-containing 32 (TRIM32), transcript variant 2 |
CNY 4,840.00 |
|
PH301289 | TRIM32 MS Standard C13 and N15-labeled recombinant protein (NP_036342) |
CNY 19,520.00 |
|
PH323796 | TRIM32 MS Standard C13 and N15-labeled recombinant protein (NP_001093149) |
CNY 14,250.00 |
|
TP323796 | Purified recombinant protein of Homo sapiens tripartite motif-containing 32 (TRIM32), transcript variant 2, 20 µg |
CNY 2,900.00 |