APE1 (APEX1) (NM_080648) Human Recombinant Protein
CAT#: TP301208
Recombinant protein of human APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 2, 20 µg
View other "APE1" proteins (13)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201208 protein sequence
Red=Cloning site Green=Tags(s) MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVD GLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPL KVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGD LNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGW RLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_542379 |
Locus ID | 328 |
UniProt ID | P27695 |
Refseq Size | 1497 |
Cytogenetics | 14q11.2 |
Refseq ORF | 954 |
Synonyms | APE; APE1; APEN; APEX; APX; HAP1; REF1 |
Summary | The APEX gene encodes the major AP endonuclease in human cells. It encodes the APEX endonuclease, a DNA repair enzyme with apurinic/apyrimidinic (AP) activity. Such AP activity sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. The AP sites are the most frequent pre-mutagenic lesions that can prevent normal DNA replication. Splice variants have been found for this gene; all encode the same protein. Disruptions in the biological functions related to APEX are associated with many various malignancies and neurodegenerative diseases.[provided by RefSeq, Dec 2019] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Base excision repair |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400618 | APEX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409118 | APEX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409119 | APEX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429949 | APEX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400618 | Transient overexpression lysate of APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 1 |
CNY 3,080.00 |
|
LY409118 | Transient overexpression lysate of APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 2 |
CNY 3,080.00 |
|
LY409119 | Transient overexpression lysate of APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 3 |
CNY 3,080.00 |
|
LY429949 | Transient overexpression lysate of APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 3 |
CNY 3,080.00 |
|
PH301208 | APEX1 MS Standard C13 and N15-labeled recombinant protein (NP_542379) |
CNY 19,520.00 |
|
PH313298 | APEX1 MS Standard C13 and N15-labeled recombinant protein (NP_542380) |
CNY 19,520.00 |
|
TP313298 | Recombinant protein of human APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP720082 | Recombinant protein of human APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 1 |
CNY 1,800.00 |
|
TP760021 | Recombinant protein of human APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |